KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_01860Help
Entry
KPHS_01860        CDS       T01733                                 

Definition
3-hydroxyacyl-CoA dehydrogenase/3-hydroxybutyryl-CoA epimerase/delta(3)-cis-delta(2)-trans-enoyl-CoA isomerase/enoyl-CoA hydratase
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KPHS_01860
   01212 Fatty acid metabolism
    KPHS_01860
  Carbohydrate metabolism
   00640 Propanoate metabolism
    KPHS_01860
   00650 Butanoate metabolism
    KPHS_01860
  Lipid metabolism
   00071 Fatty acid degradation
    KPHS_01860
   01040 Biosynthesis of unsaturated fatty acids
    KPHS_01860
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KPHS_01860
   00310 Lysine degradation
    KPHS_01860
   00380 Tryptophan metabolism
    KPHS_01860
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KPHS_01860
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    KPHS_01860
   00281 Geraniol degradation
    KPHS_01860
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    KPHS_01860
Enzymes [BR:kpm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     KPHS_01860
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     KPHS_01860
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     KPHS_01860
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     KPHS_01860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(205746..207935)
Genome map
AA seq 729 aa AA seqDB search
MLYKGDTLYLDWLEDGIAELVFDAPGSVNKLDTATVASLGHALDVLEKQSDLKGLLLRSE
KAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTISAVNGYALGGGCEC
VLATDYRLATPDLRIGLPETKLGIMPGFGGSVRLPRLLGADSALEIIAAGKDVGADQALK
IGLVDGVVAAEKLRDGALAILRQAMNGDLDWKAKRQPKLEPLKLSKIEAAMSFTIAKGMV
AQTAGKHYPAPITAVKTIEAAARLGREEALVLENKSFVPLAHTNEARALVGIFLNDQYVK
AKAKKLTKDVETPKHAAVLGAGIMGGGIAYQSAWKGVPVVMKDISDKSLTLGMTEAAKLL
NKQLERGKIDGLKLAGVISTIQPTLEYSGFDRVDVVVEAVVENPKVKKAVLAETESKVRP
DTVLASNTSTIPISELASVLQRPENFCGMHFFNPVHRMPLVEVIRGEKTSDNTIAKVVAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKVDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKDDSKGKP
KKEEDAAVDSLLADVSQSKRDFSDEEIIARMMIPMVNEVVRCLEEGIIASPAEADMALVY
GLGFPPFHGGAFRWLDTIGSAKYLDIAQQYQHLGPLYEVPAGLRDKARHNEAYYPQVEPA
RPVGALKTA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctctacaaaggcgacaccctgtacctcgactggctggaagatggcatcgccgaactg
gtgttcgatgccccaggttcggtcaacaagcttgataccgcaaccgtagccagcctcggt
catgcgctggacgtactggaaaaacaaagcgatctcaaaggtctgctgctgcgctctgaa
aaagcggcatttatcgtcggcgcggatatcaccgaattcctctcgctgttcctggtccct
gaggagcagttaagccagtggctgcattttgctaacagcgtcttcaatcgtctggaagat
ctccccgtccccactatctctgccgtcaatggctatgcgctgggcggcggttgcgaatgc
gtgctggcgaccgattaccgcctggcgacgccggacctgcgcattgggctgccggaaacc
aagctcggcattatgccgggcttcggcggttccgtgcgtctgccgcgcctgctcggcgcc
gatagcgcgctggaaattattgccgccgggaaagacgtcggcgccgatcaagcactgaaa
atcggcctggtggatggcgtggtcgctgcggaaaaactacgcgacggcgcgctggcgatc
ctacgtcaggccatgaatggcgacctggactggaaagcgaaacgtcagccgaagctggag
ccgctgaagctcagcaaaattgaagccgccatgagcttcacgattgccaaaggcatggtc
gcgcaaaccgccgggaagcattacccggcgccgatcaccgcggtcaaaaccattgaagcc
gccgcgcgtcttggtcgtgaagaagccctggtgctggaaaataaaagctttgtcccgctg
gcccataccaatgaggcccgcgcgctggttggtatcttcctgaacgaccagtacgtcaaa
gcgaaagcgaaaaagctgaccaaagatgtcgagacgccgaagcatgctgccgtcctgggc
gctggcattatgggcggcggtatcgcttaccagtcggcctggaagggcgtgccggtggtg
atgaaagacatcagcgacaaatcgctgacccttggcatgaccgaagcggcgaagctgctg
aataaacagctggaacgcggcaaaatcgacggtctgaagctggccggagtgataagcacc
attcagccaaccctggaatacagcggttttgatcgcgtcgacgtggttgttgaagcggtg
gtcgaaaacccgaaagtgaagaaagccgtactagcggaaaccgagtcaaaagtgcgcccg
gataccgtgctggcgtccaacacctcaacgatccccatcagcgagctggccagcgttctg
cagcgcccggaaaacttctgcggtatgcacttctttaacccggtgcatcgcatgccgctg
gttgaagtgatccgcggcgaaaaaacctcggataataccattgccaaagtggtggcctgg
gccagcaaaatgggcaaaacgccgatcgtggtgaatgattgtcccggcttcttcgtcaac
cgggtactgttcccctacttcgccggcttcagccagctgctgcgcgacggagcggacttc
cgcaaagtcgacaaagtgatggagaaacagtttggctggccgatgggcccggcttatcta
ctggacgtggtcggcatcgataccgcgcaccatgctcaggcggtcatggcggcgggcttc
ccgcagcggatgcagaaagattatcgcgacgccatcgacgccctgtttgacgccaaccgt
ttcggccagaagaacggcctcggcttctggcgctataaagacgacagcaaaggtaagccg
aagaaagaagaagatgctgccgtcgacagcctgctggccgacgtcagccagtcgaagcgc
gatttcagcgatgaagagattatcgcccgcatgatgatcccgatggttaacgaagtcgtc
cgctgcctggaagaaggcattatcgccagcccggcggaagcggatatggcgctggtatac
ggcctgggcttccctccgttccacggcggcgcattccgctggctggacaccatcggcagc
gcgaagtatctcgatatagcgcagcaataccagcaccttggcccgctgtatgaagtgcca
gccggtctgcgtgacaaagcgcgccataacgaagcgtattatccccaggtagagccagcc
cgtccggttggcgctctgaaaacggcttaa

DBGET integrated database retrieval system