KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_02290Help
Entry
KPHS_02290        CDS       T01733                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KPHS_02290
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KPHS_02290
   00630 Glyoxylate and dicarboxylate metabolism
    KPHS_02290
Enzymes [BR:kpm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     KPHS_02290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
264590..266191
Genome map
AA seq 533 aa AA seqDB search
MTQQATITDELAFSQPYGEQEKQILTPEAVEFLTELVSRFTPARNKLLAARLQQQQAIDD
GQLPDFISETASIRNGDWTIRGIPADLQDRRVEITGPVERKMVINALNANVKVFMADFED
SLAPDWRKVIDGQINLRDAVNGTISYTNEAGKIYQLQPNPAVLVCRVRGLHLPEKHVTWR
NEAIPGSLFDFALYFFHNYQALLAKGSGPYFYLPKTQAWQEAAWWNDVFSFTEDRFDLPR
GTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTLKNHPDRVLPDRQV
VTMDKPFLSAYSRLLIKTCHKRGAFAMGGMAAFIPSKDTERNRQVLSKVTADKELEANNG
HDGTWIAHPGLADTAMAVFDRVLGDKPNQLSVTRSEDAPITAEQLLAPCEGERTEAGMRA
NIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHQKTLNDGTPVTKALFR
QWLAEELMVIQEELGEHRFSHGRFDDAARLMEQITTSDELIDFLTLPGYRLLA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagcaggcgacaatcaccgatgaactggcctttagtcagccctatggcgagcag
gagaagcagatcttaacgcctgaggcggtagaatttctgacggaactggtgagccgcttt
acgccggcgcgcaataagctgctggccgctcgtttgcagcaacagcaggctattgacgac
gggcagcttccggattttatttcggaaactgcttccattagaaatggcgactggactatt
cgcggtatcccggctgatttgcaggatcgccgcgtggaaatcaccggccccgtcgagcgc
aagatggtcattaacgcgctgaatgccaacgtcaaagtctttatggcggactttgaggat
tcgctggcgcctgactggcgcaaagtcattgatggtcaaatcaacctgcgcgatgccgtg
aacggaaccatcagctacaccaacgaggccggcaaaatctatcagttgcagcccaatccc
gctgtgctggtatgccgtgtgcgcggcctgcatctgccggaaaagcatgtgacctggcgt
aatgaggccatccccggcagcctgttcgattttgcgctctatttctttcataactaccag
gcgctgctggcgaaaggaagtggtccctacttctatctgccaaaaacacaggcctggcag
gaggcggcatggtggaacgatgtcttcagttttacggaagatcgctttgacctgccgcgc
ggcaccatcaaggccacgctgctgattgagacgctgccagcggtgttccagatggatgag
atcctgcatgcgctgcgcgaccatattgttggcctgaactgcggccgctgggattacatc
ttcagctatatcaagacgctgaaaaaccatccggatcgcgtactgccggaccggcaggtg
gtgacgatggataaacccttcctcagcgcctactcacgcttgttgattaagacctgccac
aaacgcggcgcgtttgcgatgggcggtatggcggcgtttatcccgagcaaagataccgaa
cgtaaccgccaggtgctgagtaaagtcaccgccgataaagagctggaggcaaacaacggt
cacgatgggacctggatcgcccacccgggcctggcggataccgccatggcggtgtttgac
cgcgtgctgggcgataagccgaatcagctctcggtcacccggagcgaggatgcgccaatt
accgctgaacaactgctggctccctgtgagggcgaacgcacggaagccggaatgcgcgcc
aacattcgcgtggcggtgcagtacatcgaagcgtggatctccggcaacggctgcgtaccg
atttatggcctgatggaagacgccgcaacggccgagatctcgcgcacctctatctggcag
tggatccatcatcagaaaaccctgaacgacggtaccccggtcactaaggcgctgttccgc
cagtggctggcggaagagctgatggtgattcaggaggagctgggagagcaccgcttcagc
cacggccgctttgacgatgcggcgcgactgatggagcagatcaccacctccgacgagcta
attgattttctgacattgccgggctaccgcctgctggcctaa

DBGET integrated database retrieval system