KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_02290Help
Entry
KPHS_02290        CDS       T01733                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KPHS_02290
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KPHS_02290
   00630 Glyoxylate and dicarboxylate metabolism
    KPHS_02290
Enzymes [BR:kpm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     KPHS_02290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
264590..266191
Genome map
AA seq 533 aa AA seqDB search
MTQQATITDELAFSQPYGEQEKQILTPEAVEFLTELVSRFTPARNKLLAARLQQQQAIDD
GQLPDFISETASIRNGDWTIRGIPADLQDRRVEITGPVERKMVINALNANVKVFMADFED
SLAPDWRKVIDGQINLRDAVNGTISYTNEAGKIYQLQPNPAVLVCRVRGLHLPEKHVTWR
NEAIPGSLFDFALYFFHNYQALLAKGSGPYFYLPKTQAWQEAAWWNDVFSFTEDRFDLPR
GTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTLKNHPDRVLPDRQV
VTMDKPFLSAYSRLLIKTCHKRGAFAMGGMAAFIPSKDTERNRQVLSKVTADKELEANNG
HDGTWIAHPGLADTAMAVFDRVLGDKPNQLSVTRSEDAPITAEQLLAPCEGERTEAGMRA
NIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHQKTLNDGTPVTKALFR
QWLAEELMVIQEELGEHRFSHGRFDDAARLMEQITTSDELIDFLTLPGYRLLA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagcaggcgacaatcaccgatgaactggcctttagtcagccctatggcgagcag
gagaagcagatcttaacgcctgaggcggtagaatttctgacggaactggtgagccgcttt
acgccggcgcgcaataagctgctggccgctcgtttgcagcaacagcaggctattgacgac
gggcagcttccggattttatttcggaaactgcttccattagaaatggcgactggactatt
cgcggtatcccggctgatttgcaggatcgccgcgtggaaatcaccggccccgtcgagcgc
aagatggtcattaacgcgctgaatgccaacgtcaaagtctttatggcggactttgaggat
tcgctggcgcctgactggcgcaaagtcattgatggtcaaatcaacctgcgcgatgccgtg
aacggaaccatcagctacaccaacgaggccggcaaaatctatcagttgcagcccaatccc
gctgtgctggtatgccgtgtgcgcggcctgcatctgccggaaaagcatgtgacctggcgt
aatgaggccatccccggcagcctgttcgattttgcgctctatttctttcataactaccag
gcgctgctggcgaaaggaagtggtccctacttctatctgccaaaaacacaggcctggcag
gaggcggcatggtggaacgatgtcttcagttttacggaagatcgctttgacctgccgcgc
ggcaccatcaaggccacgctgctgattgagacgctgccagcggtgttccagatggatgag
atcctgcatgcgctgcgcgaccatattgttggcctgaactgcggccgctgggattacatc
ttcagctatatcaagacgctgaaaaaccatccggatcgcgtactgccggaccggcaggtg
gtgacgatggataaacccttcctcagcgcctactcacgcttgttgattaagacctgccac
aaacgcggcgcgtttgcgatgggcggtatggcggcgtttatcccgagcaaagataccgaa
cgtaaccgccaggtgctgagtaaagtcaccgccgataaagagctggaggcaaacaacggt
cacgatgggacctggatcgcccacccgggcctggcggataccgccatggcggtgtttgac
cgcgtgctgggcgataagccgaatcagctctcggtcacccggagcgaggatgcgccaatt
accgctgaacaactgctggctccctgtgagggcgaacgcacggaagccggaatgcgcgcc
aacattcgcgtggcggtgcagtacatcgaagcgtggatctccggcaacggctgcgtaccg
atttatggcctgatggaagacgccgcaacggccgagatctcgcgcacctctatctggcag
tggatccatcatcagaaaaccctgaacgacggtaccccggtcactaaggcgctgttccgc
cagtggctggcggaagagctgatggtgattcaggaggagctgggagagcaccgcttcagc
cacggccgctttgacgatgcggcgcgactgatggagcagatcaccacctccgacgagcta
attgattttctgacattgccgggctaccgcctgctggcctaa

DBGET integrated database retrieval system