KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_02300Help
Entry
KPHS_02300        CDS       T01733                                 

Definition
(RefSeq) isocitrate lyase
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KPHS_02300
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    KPHS_02300
Enzymes [BR:kpm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     KPHS_02300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
266256..267575
Genome map
AA seq 439 aa AA seqDB search
MEHLHMKTRTQQIEELNKEWTNPRWEGITRPYSAEEVVKLRGSVNPECTLAQLGAAKLWR
LLHGEAKKGYVNSLGALTGGQALQQAKAGIEAIYLSGWQVAADANLASSMYPDQSLYPAN
SVPAVVDRINNTFRRADQIQWSAGIEPNDPRFIDYFLPIVADAEAGFGGVLNAFELMKSM
IEAGAAAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVMGVPTLVIARTDA
DAADLITSDCDPYDREFITGDRTSEGFFRTHAGIEQAISRGLAYAPYADLVWCETSKPDL
EQARRFAEAIHARFPGKLLAYNCSPSFNWKKNLDDKTIASFQQQLSDMGYKYQFITLAGI
HSMWFNMFDLAHAYAQGEGMRHYVEKVQQPEFAAGPEGYTFVSHQQEVGTGYFDKVTTII
QGGTSSVTALTGSTEEEQF
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggagcatctgcacatgaaaacccgtacccaacaaatcgaagaattaaacaaagaatgg
acgaacccgcgctgggaaggcattacccgtccctacagcgcggaagaggtggtgaagtta
cgcggctcggtgaatccggaatgcacgctggcgcagcttggcgcggcgaaactgtggcgt
ctgctgcacggggaggcgaaaaaagggtacgtcaacagtctcggcgcgctgaccggcggc
caggccttgcagcaggcgaaggcgggtatcgaagccatttatctctccggctggcaggtg
gcggcggatgctaacctggcgtccagcatgtatccggatcaatcgctgtatccggccaac
tcggtaccggcggtggtggatcggatcaacaacaccttccgccgcgccgatcagatccag
tggtcagcgggaattgaaccgaacgatccgcgctttatcgactacttcctgccgatcgtg
gcggatgcggaggccggttttggcggcgtcctgaacgcctttgagctgatgaaatcgatg
attgaagccggtgcagcggctgttcacttcgaagatcagctggcatcggtgaagaagtgc
ggccatatgggcggtaaagtgctggttccgactcaggaagcgattcagaagctggtggcg
gcgcgtctggcggccgacgtgatgggggtcccgacgctggtcatcgcccgtaccgatgcc
gacgccgcggatttaattacctcagactgcgatccgtacgatcgtgagtttattaccggg
gatcgcaccagcgaagggttcttccgcacccacgccgggatcgagcaggcgatcagccgc
gggctggcctacgcgccgtatgcggatctggtgtggtgtgaaacgtcgaaaccggatctc
gagcaggcgcgccgctttgccgaggctatccatgcgcgtttcccgggcaaactgctggcc
tataactgctcgccgtcgtttaactggaagaaaaatcttgatgataaaaccatcgccagc
ttccagcagcagctgtcggacatgggatacaaataccagtttattaccctcgcggggatc
cacagcatgtggttcaacatgttcgacctcgcccatgcctacgctcagggtgaggggatg
cgccactatgttgagaaagtgcagcagccggaattcgccgccgggccggaaggctacacc
ttcgtctcgcatcagcaggaggtgggcaccggctacttcgacaaggtcaccaccattatc
cagggtggtacctcgtcggtaacggcgctgaccggctcgaccgaagaagagcagttttaa

DBGET integrated database retrieval system