KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_02300Help
Entry
KPHS_02300        CDS       T01733                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:kpm01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:kpm00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
266256..267575
Genome map
AA seq 439 aa AA seqDB search
MEHLHMKTRTQQIEELNKEWTNPRWEGITRPYSAEEVVKLRGSVNPECTLAQLGAAKLWR
LLHGEAKKGYVNSLGALTGGQALQQAKAGIEAIYLSGWQVAADANLASSMYPDQSLYPAN
SVPAVVDRINNTFRRADQIQWSAGIEPNDPRFIDYFLPIVADAEAGFGGVLNAFELMKSM
IEAGAAAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVMGVPTLVIARTDA
DAADLITSDCDPYDREFITGDRTSEGFFRTHAGIEQAISRGLAYAPYADLVWCETSKPDL
EQARRFAEAIHARFPGKLLAYNCSPSFNWKKNLDDKTIASFQQQLSDMGYKYQFITLAGI
HSMWFNMFDLAHAYAQGEGMRHYVEKVQQPEFAAGPEGYTFVSHQQEVGTGYFDKVTTII
QGGTSSVTALTGSTEEEQF
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggagcatctgcacatgaaaacccgtacccaacaaatcgaagaattaaacaaagaatgg
acgaacccgcgctgggaaggcattacccgtccctacagcgcggaagaggtggtgaagtta
cgcggctcggtgaatccggaatgcacgctggcgcagcttggcgcggcgaaactgtggcgt
ctgctgcacggggaggcgaaaaaagggtacgtcaacagtctcggcgcgctgaccggcggc
caggccttgcagcaggcgaaggcgggtatcgaagccatttatctctccggctggcaggtg
gcggcggatgctaacctggcgtccagcatgtatccggatcaatcgctgtatccggccaac
tcggtaccggcggtggtggatcggatcaacaacaccttccgccgcgccgatcagatccag
tggtcagcgggaattgaaccgaacgatccgcgctttatcgactacttcctgccgatcgtg
gcggatgcggaggccggttttggcggcgtcctgaacgcctttgagctgatgaaatcgatg
attgaagccggtgcagcggctgttcacttcgaagatcagctggcatcggtgaagaagtgc
ggccatatgggcggtaaagtgctggttccgactcaggaagcgattcagaagctggtggcg
gcgcgtctggcggccgacgtgatgggggtcccgacgctggtcatcgcccgtaccgatgcc
gacgccgcggatttaattacctcagactgcgatccgtacgatcgtgagtttattaccggg
gatcgcaccagcgaagggttcttccgcacccacgccgggatcgagcaggcgatcagccgc
gggctggcctacgcgccgtatgcggatctggtgtggtgtgaaacgtcgaaaccggatctc
gagcaggcgcgccgctttgccgaggctatccatgcgcgtttcccgggcaaactgctggcc
tataactgctcgccgtcgtttaactggaagaaaaatcttgatgataaaaccatcgccagc
ttccagcagcagctgtcggacatgggatacaaataccagtttattaccctcgcggggatc
cacagcatgtggttcaacatgttcgacctcgcccatgcctacgctcagggtgaggggatg
cgccactatgttgagaaagtgcagcagccggaattcgccgccgggccggaaggctacacc
ttcgtctcgcatcagcaggaggtgggcaccggctacttcgacaaggtcaccaccattatc
cagggtggtacctcgtcggtaacggcgctgaccggctcgaccgaagaagagcagttttaa

DBGET integrated database retrieval system