KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_03180Help
Entry
KPHS_03180        CDS       T01733                                 

Definition
(RefSeq) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
kpm00010  Glycolysis / Gluconeogenesis
kpm00620  Pyruvate metabolism
kpm00640  Propanoate metabolism
kpm00680  Methane metabolism
kpm01100  Metabolic pathways
kpm01110  Biosynthesis of secondary metabolites
kpm01120  Microbial metabolism in diverse environments
kpm01130  Biosynthesis of antibiotics
kpm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPHS_03180
   00620 Pyruvate metabolism
    KPHS_03180
   00640 Propanoate metabolism
    KPHS_03180
  Energy metabolism
   00680 Methane metabolism
    KPHS_03180
Enzymes [BR:kpm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     KPHS_03180
Lipid biosynthesis proteins [BR:kpm01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   KPHS_03180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 11845305
NCBI-ProteinID: YP_005224618
UniProt: A0A0H3GL37
Position
complement(358071..360029)
Genome map
AA seq 652 aa AA seqDB search
MSQIHKHPIPANIAERCLINPDQYKAQYQQSITDPDTFWGEQGKILDWMRPYTRVKNTSF
APGNISIKWYEDGTLNLAANCLDRHLAERGDQTAIIWEGDDASQSKHITYRELHADVCRF
ANVLLDLGIKKGDVVAIYMPMVPEAAVAMLACARIGAIHSVIFGGFSPEAVAGRIIDSSS
RLVITADEGLRAGRAIPLKKNVDDALKNPNVKSIEHVVVLKRTGGNIDWQEGRDLWWSDL
IANASAEHRPVEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDI
YWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMCQVVDKHKVSILYTAPTA
IRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVMDTWWQTETGG
FMITPLPGAIELKAGSATRPFFGVQPVLVDNEGLPLDGATEGNLAIADSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVSHP
KIAEAAVVGIPHNIKGQAIYAYVTLNHGEEPTPELYAEVRNWVRKEIGPLATPDVLHWTD
SLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQAITMPS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaattcacaaacaccctattcccgctaatattgcggaacgttgcctgattaac
ccggatcagtacaaggcgcagtaccaacaatccataaccgaccctgatacattttggggc
gagcagggcaagatccttgactggatgcggccctatacccgtgtaaagaacacctccttc
gcaccgggtaatatttccatcaaatggtatgaagatggcaccctgaacctcgccgctaac
tgtctcgaccgccacctcgccgaacgcggcgatcaaaccgccatcatctgggaaggcgac
gacgccagccaaagcaagcacatcacctaccgtgaactgcatgccgacgtgtgccgtttc
gccaatgtgctgctcgacctcgggattaaaaaaggcgacgtggtcgctatctatatgccg
atggtgccggaagccgcggtggcgatgctggcctgcgcccgcatcggggcaatccactcg
gtcattttcggcggcttctcgccggaggcggtggccggacgcattatcgactccagctca
cgcctggtgatcaccgctgacgaagggctgcgcgccggtcgcgccatcccgctgaagaaa
aacgtcgatgacgcgctgaaaaacccgaacgtgaaaagcattgagcacgtggtggtcctg
aaacgcaccggcggcaatatcgactggcaggaaggccgcgatctgtggtggagcgacctg
attgcaaacgccagcgccgaacaccggcccgtcgaaatgaacgccgaagatccgctgttc
atcctctatacctccggctccaccggtaaaccgaaaggggtgctgcacaccaccggcggc
tatctggtctatgcggccaccacctttaaatacgttttcgactaccatccgggcgatatt
tattggtgcaccgccgacgtgggctgggtcaccggccatagctatctgctgtacggccca
ctggcctgcggcgccaccaccctgatgttcgaaggggtgccgaactggcctacgccggcg
cgcatgtgccaggtcgtcgataagcataaggtcagcattctctataccgccccgacggct
attcgcgccctgatggcggaaggcgacaaagctatcgaaggcacagaccgctcctcgctg
cgcattcttggctcggtcggcgaaccgattaacccggaagcctgggagtggtactggaag
aagatcggtaacgagaagtgcccggtgatggacacctggtggcagaccgaaaccggcggc
tttatgatcactccgctgccgggcgcgattgagctgaaggccggctccgcgacgcgtccg
ttcttcggtgtccagccggtgctggtggataacgaaggcctgccgctggatggcgccacc
gaaggcaacctcgccatcgccgactcctggcccggccaggcgcgtaccctgttcggcgac
catgagcgctttgagcaaacctacttctccactttcaaaaatatgtactttagcggcgac
ggcgcgcgtcgtgatgaagatggctattactggatcaccggccgggtggatgacgtcctg
aacgtctccggacaccgtctggggaccgccgagatcgaatcggcgctggtgtcgcaccca
aaaatcgccgaagcggcggtggtggggatcccgcataacatcaaaggccaggccatctat
gcctacgtgacgctcaatcacggcgaagaaccgacgccggagttgtatgccgaagtgcgt
aactgggtacgcaaagagatcggtccgctggcgacgccggatgtgctgcactggaccgat
tcgctgccgaaaacccgctcgggcaaaatcatgcgccgcattctgcgtaagattgccgca
ggcgacaccagcaacctcggcgatacctcgaccctcgccgatcctggcgtcgtggaaaaa
ctgctcgaagagaagcaggccattaccatgccatcgtaa

DBGET integrated database retrieval system