KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_04530Help
Entry
KPHS_04530        CDS       T01733                                 

Definition
hypothetical protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:kpm00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
487935..488630
Genome map
AA seq 231 aa AA seqDB search
MEVYDGNQPINVASKKDDSPVTAADIAAHKVIVSGLQALDPDTPILSEEDPPSWEVRQHW
QRYWLVDPLDGTKEFIKRNGEFTVNIALIENGKPTLGVVYAPVMKVMYSAQNGKAWKEEC
GVRKQIQVRDARPPLVVISRSHSNDPELQEYLEQLGEHQTTSIGSSLKFCLVAEGQAQLY
PRFGPTSTWDTAAGHAVAVAAGAHVHDWQGKTLDYTPRESFLNPGFRVSIY
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggaagtctacgatggaaaccagccgatcaacgtcgccagcaagaaagatgattctccg
gtcacggcggcggatatcgcagcgcataaagtcattgtcagcggcctgcaggcgctggat
ccggataccccgatcctctccgaggaggacccgccgtcctgggaagtgcgccagcactgg
cagcgctactggttggtcgacccgctggacggcaccaaagagtttattaagcgtaacggc
gaattcaccgtcaatatcgcgctgattgaaaacggcaagccgacgctgggcgttgtctat
gcgccggtgatgaaggtgatgtacagcgcgcaaaatggcaaagcctggaaagaagagtgc
ggcgtacgcaagcagatccaggtccgcgatgcccgtccgccgctggtggtgattagccgc
tcccatagcaacgatccggagctgcaggagtatcttgagcaacttggcgaacaccagacc
acctcaatcggttcgtcgctgaaattctgcctggtggcggaaggtcaggcccagctctat
ccgcgcttcgggccgaccagcacctgggacaccgccgccggccatgcggtcgcggtggcc
gccggggcgcatgttcacgactggcaggggaaaaccctcgactacacgccgcgtgaatcc
ttccttaaccccggcttccgggtctctatttattaa

DBGET integrated database retrieval system