KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_05040Help
Entry
KPHS_05040        CDS       T01733                                 

Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    KPHS_05040
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KPHS_05040
Enzymes [BR:kpm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     KPHS_05040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(539534..540469)
Genome map
AA seq 311 aa AA seqDB search
MANPLYQKHIISINDLSREDLELVLATAAKLKANPQPELLKHKVIASCFFEASTRTRLSF
ETSMHRLGASVVGFSDSANTSLGKKGETLADTISVISTYVDAIVMRHPQEGAARLATEFS
GGVPVLNAGDGANQHPTQTLLDLFTIQETQGRLENLNVAMVGDLKYGRTVHSLTQALAKF
NGNRFYFIAPDALAMPQYILDMLDEKGIAWSLHSAIDDVMAEVDILYMTRVQKERLDPSE
YANVKAQFVLRAADLEGARANMKVLHPLPRIDEITTDVDKTPHAWYFQQAGNGIFARQAL
LALVLNSELAL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggctaacccgctatatcaaaaacatatcatttccataaacgatctcagccgcgaagac
ctcgaactggtgctggcgacggcggcaaagctgaaagccaatccacaacccgagctgctg
aagcataaggttatcgccagctgtttctttgaagcctcgacccgcacccgcctctctttt
gaaacctcgatgcaccgcctgggcgccagcgtggtcggcttttccgacagcgccaacacc
tcactgggcaaaaaaggggaaacgctggcggataccatctccgtcatcagcacctacgtc
gacgccatcgtgatgcgtcatccgcaggagggcgccgcgcgcctggcgaccgaattctcc
ggcggcgtgccggtactgaacgccggcgacggcgctaaccagcacccgacccaaaccctg
ctcgacctgttcaccattcaggagacccagggccgcctcgaaaacctcaacgtggcgatg
gtcggcgatctgaagtatggccgtaccgtccactccctgacccaggcgctggccaaattc
aacggcaaccgcttctacttcatcgccccggacgcgctggccatgccgcagtacatcctc
gatatgctcgatgaaaaaggcatcgcctggagcctgcatagcgccatcgacgacgtgatg
gcggaagtggatattctgtacatgacccgcgtgcagaaagagcgtctggatccgtcggaa
tacgccaacgtcaaagcgcagttcgtcctgcgcgccgccgacctcgaaggggcgcgcgcc
aacatgaaagtgctgcacccgctgccgcgcattgatgaaatcaccaccgatgtcgataaa
acaccgcacgcctggtacttccagcaggccggtaacggcatcttcgcccgccaggcgtta
ctggcactggtactgaatagcgagctggcactgtaa

DBGET integrated database retrieval system