KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_06910Help
Entry
KPHS_06910        CDS       T01733                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:kpm00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
727422..728744
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGQALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMSMPERVSLT
MAMRDSGTVLDWKSLNLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLEAIPGFDIFPDDNRFREIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYELSAALAEAIVGVANGAGVRTTALLT
DMNQVLASSAGNAVEVREAVQFLTGEYRNPRLFDVTMALCVEMLISGKLAADDAEARAKL
QAVLDNGKAAEVFGRMVAAQKGPSDFVENYANYLPTAMLSKAVYADTEGFISAMDTRALG
MAVVSMGGGRRQASDTIDYSVGFTEMARLGDRVDGQRPLAVIHAKDENSWQEAAKAVKAA
IKLDDKAPEITPTVYRRITE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgtttctcgcacaagaaattattcgtaaaaaacgtgatggtcaggcattaagcgatgaa
gagatccgctttttcatcaacggcatccgcgacaatactatctctgaagggcagatcgcc
gcgctggcgatgaccatcttcttccacgatatgtctatgccggagcgcgtttcgctgacc
atggcgatgcgggattccggtaccgttctggactggaaaagcctcaaccttaacggtccg
atcgtcgataaacactctaccggcggcgtcggggatgtcacttcgctgatgctggggccg
atggtggccgcctgcggtggttacgtaccgatgatctccggccgcggcctcggccatacc
ggcggtacgctggacaaactggaagcgatcccgggcttcgatatcttcccggacgacaac
cgcttccgcgagattattaaagatgttggcgtggcaattatcgggcagaccagctccctt
gccccggccgacaaacgtttctatgccacccgcgatattaccgcgacggtggactccatc
ccgctgattaccgcctcgattctggcgaagaagctggcggaagggctggatgcgctggtg
atggacgtcaaagtcggcagcggcgcgtttatgccgacttatgaactctctgccgcgctg
gccgaagcgatcgtgggtgtcgccaacggcgccggcgtgcgcaccaccgcgctgctgacc
gatatgaatcaggtactggcctccagcgccggcaacgccgttgaagttcgcgaagcggtg
cagttcctgaccggcgaataccgcaacccgcgcctgttcgacgtgacaatggcgctgtgt
gtggaaatgctgatctccggcaagctggcggcggacgatgccgaggcgcgcgcgaagctg
caggcggtgctggataacggtaaagcggcggaagtgtttggccgcatggtcgcggcgcag
aaagggccgagcgactttgtcgagaattatgctaattatctgccgacggcgatgctgagc
aaagcagtctatgctgataccgaaggttttatcagcgcgatggatactcgcgcgctgggc
atggcagtggtttctatgggcggcggccgccgtcaggcatcggacaccattgactatagc
gttggctttaccgagatggcgcgtctgggtgaccgcgtcgacggacagcgtccgctggcg
gtgatccatgccaaagacgagaacagctggcaggaggccgcgaaagcggtcaaagcggcc
attaaactggacgataaagccccggaaattacaccgacagtctatcgccgtatcactgaa
tag

DBGET integrated database retrieval system