KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_07140Help
Entry
KPHS_07140        CDS       T01733                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:kpm01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:kpm00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:kpm00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
752865..754145
Genome map
AA seq 426 aa AA seqDB search
MKLYNLKDHNEQVSFAQAVTQGLGKHQGLFFPHDLPEFSLTEIDDMLAQDFVTRSAKILS
AFIGDEIPQDVLQQRVRAAFAFPAPVSKVQEDVGCLELFHGPTLAFKDFGGRFMAQMLTH
IAGDKPVTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKISPLQEKLFCTLGGNIETV
AIDGDFDACQALVKQAFDDEELKATLGLNSANSINISRLLAQICYYFEAAAQLPQEARNQ
LVISVPSGNFGDLTAGLLAKSLGLPIKRFIAATNANDTVPRYLQGGEWAPKATQATLSNA
MDVSQPNNWPRVEELFRRKIWRLSELGYAAVDDETTKAAMRELKAIGYISEPHAAIAWRA
LRDQLQPGEYGLFLGTAHPAKFKESVEEILQETLPLPKELADRADLPLLSHNLPADFAAL
RKLMMG
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtataacttaaaagatcataacgagcaggtcagctttgcgcaggccgtcacc
cagggacttggcaagcatcagggcctgttctttccgcacgatctgccggaattcagcctg
actgaaatcgacgacatgctggcgcaggactttgtcacccgtagcgccaaaattttatcc
gcctttatcggcgatgagatcccgcaggatgtcctgcagcagcgggtgcgcgcggcgttt
gcgtttccggcgccggtaagcaaggttcaggaagatgtcggctgtctggagctgttccat
ggccctacgctggcgttcaaggatttcggcggccgctttatggcgcagatgctgacccac
atcgcaggcgataagccggtcaccatcctcaccgcgacctctggcgacaccggggcggcg
gtggcgcatgctttctacggcctgccgaacgtcaaggtagtgatcctctatccgcgcggc
aagatcagtccgctgcaggagaagctgttctgtaccctcggcggcaatattgaaaccgtg
gcgattgatggcgactttgatgcctgccaggcgctggtgaagcaggcgtttgacgatgaa
gagctgaaggcgacgctgggtctcaactcggctaactccatcaacatcagccgcctgctg
gcgcagatctgttactacttcgaagcggcggcgcagctgccgcaggaagcccgcaatcag
ctggtgatttccgtgccgagcggcaacttcggcgatctgaccgccggtctgctggccaag
tcgctggggctgccgatcaagcgctttatcgccgccaccaacgccaacgacaccgttccg
cgctatctgcagggcggcgagtgggcgccaaaagccacccaggcgacgctgtccaacgcc
atggacgtcagccagccgaacaactggccgcgcgttgaagagctgttccgccgtaaaatc
tggcgtctcagcgagctgggctatgccgcggtcgatgatgagaccaccaaagcagcgatg
cgcgagctgaaggccatcggctacatctctgaaccgcatgcggcgattgcctggcgcgcg
ctgcgcgatcagctgcagccgggagagtacggcctgttcctcggcaccgcccatccggcg
aagttcaaagagagcgtggaggagatcctgcaggagactctgccgctgccgaaggagctg
gccgaccgcgccgacctgccgctgctgtctcacaacctgccggcggatttcgccgcgctg
cgtaagctgatgatgggctaa

DBGET integrated database retrieval system