KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_08050Help
Entry
KPHS_08050        CDS       T01733                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:kpm00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:kpm00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
853879..855366
Genome map
AA seq 495 aa AA seqDB search
MADRNLRDLLAPWVPNAPERILREMTLDSRVAASGDLFIAVQGHQADGRRYIPQAIAQGV
AAIIAEAQGEAKDGEIREMHGVPVIYLSQLNERLSALAGRFYHQPSQQLRLVGVTGTNGK
TTTTQLLAQWAKLLGETSAVMGTVGNGLLDKVVPTENTTGSAVDVQHVLSSLVGQGATFG
AMEVSSHGLVQHRVAALQFAASVFTNLSRDHLDYHGDMEHYEAAKWLLYSTHHCGQAIVN
ADDEVGRRWLAKLPDAVAVSMEDHINPNCHGRWLKATAVNYHDSGATIQFDSSWGKGEIE
SRLMGAFNVSNLLLALATLLALGYPLADLLKSAARLQPVCGRMEVFSAPGKPAVVVDYAH
TPDALEKALQAARLHCSGKLWCVFGCGGDRDKGKRPLMGAIAEEFADIVVVTDDNPRTEE
PRAIINDILAGMLDAGQAKVMEGRAEAVTNAVMQAKENDVVLVAGKGHEDYQIVGNRRLD
YSDRVTVARLLGAVA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtggcagatcgtaatttgcgcgacctactcgctccatgggtgccaaacgcaccggagcgc
attctgcgagagatgacgctggacagccgggtggctgcttccggcgatctctttatcgcg
gtacagggtcatcaggcggacgggcgtcgttatatcccgcaggcgatagcgcaaggtgtg
gctgccattattgctgaagcgcagggcgaagctaaagacggtgagatccgtgaaatgcac
ggcgtgccggttatctacctgagccagcttaacgaacgcttatcggcgctggccgggcgt
ttttatcatcagccgtcgcagcagctgcgtctggtgggcgtcaccggcaccaacgggaaa
accaccaccactcagctgctggcgcagtgggcaaagctgctcggcgaaaccagcgcggtg
atggggaccgtcggtaacggtctgctggataaagtcgttccaactgaaaacaccaccggt
tccgcggtggacgttcaacatgtgctctccagtctggtcgggcagggggctaccttcggc
gcgatggaagtctcctcccatggtctggtacagcaccgcgtagcggccctgcagtttgcc
gcctcggtgtttaccaatctcagccgcgatcatctcgactaccatggcgacatggagcac
tacgaagcggcgaaatggctgctgtactccacccatcattgcggtcaggccatcgtcaat
gctgacgatgaagtcggtcgtcgctggctggcaaaactgccggacgcggtggcggtatcg
atggaagatcatatcaacccgaattgccacggccgctggctaaaggccaccgcggtgaac
tatcacgacagcggggcgaccatccagtttgactccagctggggcaagggcgaaatcgaa
agccgcctgatgggcgcctttaacgtcagcaatctgctgctggcgctggccacgctgctg
gcgctgggctatccgctggccgatctgctgaagagcgcagcgcgtttacagccggtgtgc
ggccgtatggaagtgttcagcgcgccgggtaaacctgccgtggtggtggattatgcccat
acgcctgacgcgctggaaaaagcgctgcaggcggcacgcctgcactgcagcggcaagctg
tggtgcgtcttcggctgcggcggcgaccgcgacaaaggtaaacgtccgttgatgggcgct
atcgcggaagaatttgccgacatcgtggtcgtgactgacgataacccgcgcaccgaagag
ccgcgggcgattatcaacgatattctggccggcatgctcgatgcaggtcaggcgaaggtg
atggaaggccgcgcggaagcggtgaccaacgccgtgatgcaggcgaaagagaacgacgtg
gtgctggtggcgggtaaaggccatgaagattaccagatcgtcggcaaccgccgtctggat
tattccgaccgcgtgaccgtcgcgcgtctgctgggagcggtagcatga

DBGET integrated database retrieval system