KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_08690Help
Entry
KPHS_08690        CDS       T01733                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    KPHS_08690
Enzymes [BR:kpm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     KPHS_08690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(918380..918859)
Genome map
AA seq 159 aa AA seqDB search
MTLVYIALGSNLASPLEQVQAAIRALGEIPHSRVVAVSSFYRTPPLGPQDQPDYLNAAVA
LETALPPETLLDHTQRIELQQGRVRKAERWGPRTLDLDIMLFGDAVINSERLTVPHYDMK
NRGFMLWPLFEIAPDLHFPDGPALRAVLDNLGAEKPASW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgactctggtctatatcgctcttggcagcaaccttgcttctccactggagcaggtgcag
gcggctatccgcgccctgggcgaaattccgcacagccgcgtggtcgccgtctcttcgttc
taccgcacgccgccgctgggcccgcaggatcagccggactatctcaacgccgccgttgcg
ctggaaaccgccctgccccccgagacgctgctcgatcatactcagcgcatcgaactgcag
caggggcgagtgcgcaaagccgaacgctgggggccgcgcacgctggacctcgatatcatg
ctgtttggcgatgctgtcattaacagcgagcgcctgaccgttccgcactacgatatgaaa
aaccgcggctttatgctctggccgctgttcgagatcgccccggaccttcactttcctgac
ggcccggcgctgcgcgccgtgctggataatctcggcgcggaaaagcccgccagctggtaa

DBGET integrated database retrieval system