KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_10540Help
Entry
KPHS_10540        CDS       T01733                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    KPHS_10540
Enzymes [BR:kpm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     KPHS_10540
Exosome [BR:kpm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KPHS_10540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1113347..1114321)
Genome map
AA seq 324 aa AA seqDB search
MTDLITRPRRLRQSAALRALFEETTLSLNDLVLPIFVEEEIDDYKAIEAMPGVMRIPEKY
LAREIERIANAGIRSVMTFGISHHTDATGSDTWNENGLVARMSRICKSTVPEMIVMSDTC
FCEYTSHGHCGVLCDHGVDNDATLENLGKQAVVAAAAGADFIAPSAAMDGQVQAIRRSLD
AAGFTNTAIMSYSTKFASSFYGPFREAAGTALKGDRKTYQMSPMNRREAIRESLLDEAQG
ADCLMVKPAGAYLDILRDIRERSDLPLGAYQVSGEYAMIKFAAQAGAIDEEKVVLESLGA
IKRAGADLIFSYFALDLAEKKILR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacagatttaatcactcgcccccgccgcctgcgtcaatccgctgcgctgcgcgccctg
tttgaagagacaacactgagtttgaacgacctggtgttgccgatctttgttgaagaagaa
attgatgattacaaagcgatcgaggccatgcccggcgtgatgcgcattccggaaaaatat
ctggcgcgcgagatcgaacgcatcgccaacgccgggatccgctcggtgatgacctttggt
atttctcatcacaccgatgccaccggcagcgatacctggaatgaaaatggtctggtggcg
cgtatgtcgcggatttgtaagtccacggtgccggagatgatcgtcatgtccgatacctgc
ttctgcgaatatacctcccacggccactgcggcgtgctgtgcgaccacggggtggataac
gacgcgaccctggaaaacctcggcaaacaggccgttgtcgccgccgccgcgggggcggat
ttcatcgctccttccgccgcgatggacggacaggtgcaggcgattcgccgctcgctggac
gccgccggcttcaccaatacggcgatcatgtcctactcgaccaagttcgcttcttccttc
tacggtccgttccgcgaagcggccggtaccgcgctgaagggcgatcggaaaacctatcag
atgagcccgatgaaccgccgggaggccattcgcgagtcgctgctcgatgaagcccagggc
gccgactgcctgatggtgaaaccggctggcgcctacctggatattctgcgcgatatccgc
gaacgcagcgatctgccgctcggcgcctatcaggtcagcggggagtacgcgatgatcaaa
tttgctgcccaggcgggcgctatcgatgaagagaaagtggttctggaaagcctcggcgct
atcaaacgcgcaggcgccgacctgatcttcagctatttcgccctcgatctggccgagaaa
aagatcctccgttaa

DBGET integrated database retrieval system