KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_11740Help
Entry
KPHS_11740        CDS       T01733                                 

Definition
beta-galactosidase 1
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:kpm00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1230832..1232889
Genome map
AA seq 685 aa AA seqDB search
MNKFAPLHPKVSTLLHGADYNPEQWENDPDIIDKDIAMMQQAKCNVMSVGIFSWAKLEPR
EGVFNFAWLDIILDKLYAAGIHVFLATPSGARPAWMSQRYPQVLRVGRDRVPALHGGRHN
HCMSSPVYREKTLQINTLLAERYSSHPAVLGWHISNEYGGECHCDLCQNRFRDWLKARYQ
TLENLNQAWWSTFWSHTYTDWSQIESPAPQGEMSIHGLNLDWHRFNTAQVTDFCRHEIAP
LKAANASLPVTTNFMEYFYDYDYWQLAEALDFISWDSYPMWHRDKDETALACYTAMYHDM
MRSLKGGKPFVLMESTPGATNWQPTSKLKKPGMHILSSLQAVAHGADSVQYFQWRKSRGS
VEKFHGAVVDHVGHIDTRIGREVCQLGEILSKLPEVRGCRTEAKVAIIFDQQNRWALDDA
QGPRNLGMEYEKTVNEHYRPFWEQGIAVDVIDADVDLTPYQLVIAPMLYMVRDGFAGRAE
AFVANGGHLVTTYWTGIVNESDLCYLGGFPGPLRNLLGIWAEEIDCLNDGEFNLVQGLAG
NQCGLQGPYQVRHLCELIHIESAQALATYRDDFYAGRPAVTVNAFGKGKAWHVASRNDLA
FQRDFFTALSKELALPRAIATELPPGVVATARTDGDNAFIFLQNYSAQNHTLTLPQGYRD
CLTDAAVSAPLTLSAWDCRILRRHA
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatttgcacctttacatccgaaggttagtacgctgctgcatggcgcggattat
aatccggagcaatgggagaatgaccccgatattattgataaagacattgccatgatgcag
caggcaaaatgcaatgtgatgtcggtgggaatatttagctgggcgaaactggagccacgc
gaaggggtatttaatttcgcctggctggatattatcctcgataaactgtatgccgccggc
attcatgtctttctggccacgccgagcggcgcgcgcccggcgtggatgtcgcagcgctat
ccgcaggttctgcgggtggggcgcgatcgggtgccggccctgcacggcggccgtcacaac
cactgtatgtcgtcaccggtctatcgcgagaaaaccctgcaaatcaataccctgctggca
gaacgttattcctcacacccggcggtgctgggctggcatatttccaacgaatatggcggt
gaatgccattgcgatctctgccagaaccgttttcgcgactggctgaaggcgcgttaccag
accctggagaacctcaaccaggcctggtggagcaccttctggagtcatacctatactgac
tggtcgcagattgaatcgcctgcgccgcagggcgagatgtcgatccacggtctcaatctt
gactggcatcgctttaacaccgctcaggtgaccgatttctgccgccatgaaattgctccg
ctgaaggcggcgaatgcctccctgccggtgactaccaactttatggagtatttctacgat
tacgactactggcagctggcggaggcgctggatttcatctcctgggacagctatccgatg
tggcaccgcgataaagacgaaaccgcgctggcctgttacaccgcgatgtatcacgacatg
atgcgcagcctgaagggcggcaaaccgtttgtgctgatggagtccaccccgggcgccacc
aactggcagccgaccagcaaactgaagaagccgggaatgcatattctttcctcgctgcag
gcggtggcgcatggcgccgactcggtgcagtatttccagtggcggaaaagccgcggttcg
gttgagaaatttcacggcgcagtggtcgaccacgtcggacatattgatacccgcattggc
cgcgaagtctgccagctcggcgagatcctcagcaagctgccggaggtgagaggctgtcgc
accgaggcgaaagtagcgattatcttcgaccagcagaaccgctgggcgctggatgacgcc
caggggccgcgtaatcttgggatggaatatgagaagacggtcaacgagcactaccgcccg
ttctgggagcagggcatcgccgtcgatgtgattgacgccgatgtcgatttaacgccgtat
cagttagtgattgccccgatgttatatatggtgcgcgacggctttgccggtcgggcggag
gcgtttgtcgccaacggcggccacctggtgaccacctactggaccggtatcgtcaatgag
tccgatctctgctatctcggcggcttcccgggcccgctgcgcaatctgctggggatctgg
gcggaagagatcgactgcctgaatgacggcgagtttaatctggtgcaggggcttgccggg
aatcagtgcggtctgcagggcccttatcaggtgcgccatctctgcgaactgatccatatc
gagagcgcccaggcgctggccacctaccgggatgatttttatgccggacggccggctgtg
acggtgaacgcgttcgggaaaggcaaagcctggcatgtggcctcccgcaacgatttagcc
ttccagcgcgatttctttaccgccctgagcaaggagctggccctgccgcgggcgatagcg
acggagttaccacccggcgtggtggcgactgcgcgcaccgacggtgacaacgcatttatc
ttcctgcagaactacagcgcgcaaaaccataccctgaccctgccgcaagggtatcgggat
tgcctgaccgacgcggcggtatcggctccactgaccctgtcggcatgggattgccgtatt
ctccgtcgtcacgcgtaa

DBGET integrated database retrieval system