KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_12000Help
Entry
KPHS_12000        CDS       T01733                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    KPHS_12000
DNA repair and recombination proteins [BR:kpm03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      KPHS_12000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1255079..1255684
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQYSGRYFVLMGHLSPLDGIGP
DDIGLDRLEQRLEAESITEVILATNPTVEGEATANYIAELCAQYGVDASRIAHGVPVGGE
LEMVDGTTLSHSLAGRHKITF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagcccgctgttaactcagcttatggaagcgctgcgctgtctgccgggcgtt
ggcccgaagtcggcgcagcgcatggcgtttactctgctgcagcgcgatcgcagcggcggt
atgcgcctggcgcaggcgctgacgcgcgcgatgtcggaaatcggccactgcgccgattgc
cgcaccttcaccgagcaggaggtgtgcaatatttgcagcaacccgcgtcgccaggaaaac
ggtcagatctgcgtggtggagagtccagcggacatctatgccattgagcagaccgggcag
tattccggccgctacttcgtgctgatggggcacctgtcgccgctcgacggcatcgggcct
gatgacatcgggctcgatcgcctggagcaacggctggaggcggagtcgatcaccgaggtg
atcctcgccaccaacccgaccgttgagggcgaggcgacggccaactacatcgcagagctg
tgcgcgcagtatggcgtcgacgccagccgaatcgcccacggcgtgccggtgggcggcgag
ctggagatggtcgacggcaccacgctgtcccactccctggccggtcgccacaagattact
ttctga

DBGET integrated database retrieval system