KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_12210Help
Entry
KPHS_12210        CDS       T01733                                 

Definition
acyl-CoA thioesterase I
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    KPHS_12210
Enzymes [BR:kpm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     KPHS_12210
   3.1.2  Thioester hydrolases
    3.1.2.-  
     KPHS_12210
Lipid biosynthesis proteins [BR:kpm01004]
 Fatty acid synthase
  Component type
   KPHS_12210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1275609..1276232)
Genome map
AA seq 207 aa AA seqDB search
MNFKYVFRWHVPFLLLFLFTCRAMAADTLLILGDSLSAGYRMAANAAWPALLNEQWQAKT
PVVNASISGDTSQQGLARLPALLKQHQPRWVLVELGGNDGLRGFPPQQTEQTLRTIIKDI
KAANAEPLLMQIHLPANYGRRYNEAFGAIYPALAKEFAIPLLPFFMEEVYLKPQWMQDDG
IHPNRDAQPFIADWMAKRLAPLVNHDS
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcaagtatgttttccgctggcatgtgcctttcctgttgttgttcctgtttacc
tgccgcgcgatggcggcggacacgctgctgatcctcggcgacagcctgagcgctggctat
cggatggcggccaacgccgcctggcctgcgctgctcaatgagcagtggcaggcgaaaacg
ccggtggtgaacgccagcatcagcggcgatacctcgcagcaggggttggctcgcctgcca
gcgctgcttaagcagcaccagccgcgctgggtgctggttgagctcggcggcaatgacgga
ctgcgcggttttccgccgcagcagaccgagcagacgctgcgcaccattattaaagatatc
aaagcggccaacgccgagccgctgctgatgcaaattcacctgccggcgaactatggccgc
cgctataatgaagccttcggcgcgatttacccggccctggccaaagagttcgctattcct
ctcctgcccttttttatggaggaggtctatctcaagccgcaatggatgcaggacgacggc
attcatccaaatcgcgacgcgcagccgtttatcgccgactggatggcgaagcggctggct
cccttagttaatcatgactcctga

DBGET integrated database retrieval system