KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_12590Help
Entry
KPHS_12590        CDS       T01733                                 

Definition
hypothetical protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Brite
Enzymes [BR:kpm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     KPHS_12590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1305583..1306113
Genome map
AA seq 176 aa AA seqDB search
MANLKTKLSAAMLALIAAGASAPVLMDQFLNEKEGNSLTSYRDGAGIWTICRGATRVDGR
PVTQGMKLTQVKCDEVNAVERNKALAWVDQNVRVHLTPPQKVGIASFCPYNIGPGKCFPS
TFYRKLNAGDRKGACAEIRRWIFDGGKDCRVRSNNCYGQVSRRDQESALACWGIDE
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atggctaacctgaaaacgaaactcagtgcggccatgctggcgcttatcgctgctggcgca
tcagctcccgttctcatggatcagtttctgaatgagaaagagggcaatagtctcacgtca
taccgcgatggtgcaggtatctggacgatatgccgtggagccaccagggtagatggaagg
ccagtaacgcagggaatgaagttaacccaggttaaatgcgacgaggtaaatgccgtcgag
cgcaataaggcgctggcatgggttgatcagaatgtgcgggttcatctaacacctcctcag
aaggtcgggattgccagtttctgcccctataacatcgggcccggcaaatgctttccttcc
accttctaccgcaagctgaatgccggtgaccggaaaggcgcctgcgctgaaattcgccgg
tggatttttgatggcggaaaagattgccgcgtgcgttccaacaattgttacggccaggtc
tctcgccgtgatcaggaaagcgcgctggcatgttgggggatagatgaatga

DBGET integrated database retrieval system