KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_14320Help
Entry
KPHS_14320        CDS       T01733                                 

Definition
Carbohydrate kinase, FGGY-like protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    KPHS_14320
Enzymes [BR:kpm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     KPHS_14320
Exosome [BR:kpm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KPHS_14320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1483500..1485020)
Genome map
AA seq 506 aa AA seqDB search
MQATAKEFIIALDEGTTNAKAVVLDSRGKVIVKFSQPLAIQTPRDGWVEQSGEALVTASL
TVIASAVAHVGAENVAALAISNQRETAIGWYRDSGEPINAAITWQCTRSAAFCDTLRHDR
QEQHIKRATGLPIAPLFSASKMRWLLDATVDGHLRAERGEICLGTIDSWLLWNLTAGEAF
CCDYSNASRTQLLNLHRGEWDDEMLALFGIPRAALPEIKPSSGLFGHTKGLAAIPDGIPI
MSMIGDSHAALFGHALGEAGCVKATYGTGSSVMAPVKSAQCDIDALATTVAWHDGDQLVW
GLEGNIPHTGDAVAWMADSTGLSELSAAELAHELNTLPASVDSTLGVYFVPALTGLGAPW
WDDSARGVICGLSRGVKRAHLIRAALESITYQIADVVVAMRQHEEFTLTALMVDGGPTNN
DWLMQYQADLLGCPVMRSDVPELSAIGAALLARKALHPGSTADLQAFLTEHSTFQPDMAR
HQRLQTRWQEWRHAVDRTLWKPDSPA
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcgacagcaaaagagttcatcattgccctggatgaaggcaccaccaacgccaaa
gcggtggtgctggatagccggggcaaagttatcgtcaaattctcgcagccgctggcgatc
caaacgccgcgcgacggctgggtggagcaatcgggcgaagcgctggttaccgcctcactg
acggtgatcgccagcgcggtggcccacgttggcgcggaaaacgtcgccgcgctggctatc
agcaaccagcgggaaaccgccattggctggtatcgcgacagcggcgaaccgattaacgcg
gccattacctggcaatgcacccgcagcgccgcgttctgcgacacgctgcgtcacgatcgt
caggaacagcacattaagcgtgccaccggcctgccaatcgccccgctgttctcggcctcc
aaaatgcgctggctgctggatgcgactgtcgatggccacctgcgcgccgaacgcggtgag
atttgcctcggcaccatcgacagctggctgctgtggaatctgactgctggagaagccttc
tgctgcgactactccaatgcctcccgcacccagctgctgaacctgcaccgcggcgagtgg
gacgacgagatgctggcgctgttcggcattccgcgcgcggcgttgccggaaattaaaccg
tcgagcggcctcttcggccataccaaaggactggccgccattccggacggtattccgatc
atgtcgatgatcggcgactcccacgccgcgctgttcggccacgcgctcggcgaggcaggc
tgcgtcaaagccacctacggcaccggctcttcggtcatggccccggtcaaatcggcgcag
tgcgatatcgacgcgctggcgaccaccgtcgcctggcacgatggcgaccagctggtgtgg
ggcctggaagggaatattccccacaccggcgatgctgtcgcctggatggcggacagcacc
ggactgagcgaactctctgccgccgagctggcccatgagctgaataccctccccgcctcc
gtcgactcaaccctcggggtctacttcgtgccggcgctgaccggtcttggcgcgccctgg
tgggatgacagcgcccgcggcgtgatttgcggcctgagtcgcggggtgaaacgcgcgcat
ctgatccgtgcggcgctggagtccatcacctatcagatagccgacgtggtggtggcgatg
cgtcagcatgaggagttcaccctgacggcgttgatggtggacggcgggccgaccaacaat
gactggctgatgcaataccaggccgatctgctcggctgcccggtgatgcgcagcgatgtg
ccggagctgtccgccatcggcgcggcgttgctggcgcgcaaagcgctccatccggggtcg
accgccgatctgcaggccttcttaaccgaacacagcacctttcagcccgacatggcccgc
caccagcgtttacaaacgcgctggcaggagtggcgccatgcggtcgaccgaacattatgg
aaaccggactcgccagcctga

DBGET integrated database retrieval system