KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_15280Help
Entry
KPHS_15280        CDS       T01733                                 

Definition
asparagine synthetase B
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KPHS_15280
Enzymes [BR:kpm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     KPHS_15280
Peptidases [BR:kpm01002]
 Cysteine Peptidases
  Family C44
   KPHS_15280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1590336..1592000)
Genome map
AA seq 554 aa AA seqDB search
MCSIFGVLDIKTDAGELRKKALELSRLMRHRGPDWSGVYASDKAILAHERLSIVDVNAGA
QPLYNAEKTHALAVNGEIYNHQALRAEYGDRYQFQTGSDCEVILALYQEKGPEFLDDLQG
MFAFALYDSEKDAYLIGRDHIGIIPLYMGHDEHGNFYVASEMKALVPVCRTIKEFPAGSY
LWSKDGEIRQYYQRDWFDYDAVKDNVTDKNELRQALEESVKSHLMSDVPYGVLLSGGLDS
SVISAITKKFAARRVEDQERSEAWWPQLHSFAVGLEGSPDLKAAQEVANHLGTVHHEIHF
TVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAMGIKMVLSGEGSDEVFGGYLY
FHKAPNAKELHEETVRKLQALHMFDCARANKAMSAWGVEARVPFLDKKFLDVAMRINPQD
KMCGNGKMEKHILRECFESYLPASVAWRQKEQFSDGVGYSWIDTLKEVAAKQISDQQLET
ASFRFPYNTPTSKEGYLYREIFEELFPLPSAAECVPGGPSVACSSAKAIEWDEAFKTMND
PSGRAVGVHQSAYK
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgttctatttttggcgtactggatattaaaactgacgcaggcgagctgcgtaaaaag
gcgctggagctttcccgcctgatgcgccaccgcggtccggactggtctggcgtatatgcc
agcgacaaagcgattctggcgcacgagcgcctgtcgattgtcgacgtcaacgccggggcc
cagccgctgtacaacgccgaaaaaacccatgcgctggccgttaacggcgagatctacaac
caccaggcgctgcgcgcggagtatggcgatcgctaccagttccagaccggttccgactgc
gaagtgatcctcgcgctgtatcaggaaaaaggcccggagttcctcgacgatctgcaggga
atgttcgccttcgccctgtacgacagcgaaaaagacgcgtacttaattggccgcgaccat
atcggcattatcccgctgtatatgggccatgacgaacacggcaacttctatgtcgcctcc
gaaatgaaagcgctggtgccggtatgccgcaccattaaagagttcccggcgggcagctac
ctgtggagcaaagacggcgaaattcgccagtactatcagcgcgactggtttgattacgac
gcggtgaaagacaacgttaccgataagaacgagctgcgccaggcgctggaagagtcggtg
aaaagccacctgatgtccgacgtgccttacggcgtgctgctctccggcggtcttgattca
tcggtcatctcggctatcaccaagaaattcgccgcccgtcgcgtcgaagatcaggagcgt
agcgaagcctggtggccgcagctgcactctttcgcggtcggtctggaaggctctcctgac
ctgaaagcggcgcaggaggtggccaaccacctcggcaccgtgcaccacgaaattcacttt
accgtccaggaagggctggatgccatccgcgacgttatctatcacatcgaaacctacgat
gtgaccactattcgcgcctcgacgccgatgtacctgatgtcgcggaaaattaaagccatg
ggcatcaaaatggtgctttccggcgaaggttcggacgaagtgttcggcggctacctctac
ttccataaggcgccgaacgccaaagaactgcacgaagagacggtgcgtaagctgcaggcg
ctgcatatgtttgactgcgcccgcgccaacaaagcgatgtccgcctggggcgtggaggcc
cgcgtgccgttcctcgacaagaagttcctcgacgtcgcgatgcgcattaacccgcaggat
aagatgtgcggcaacggcaaaatggaaaaacacattctgcgcgaatgctttgaatcctac
ctgccggccagcgtcgcctggcgccagaaggagcagttctctgacggcgtcggctacagc
tggatcgataccctgaaagaagtggccgccaaacagatcagcgaccagcaactggaaacc
gcaagcttccgcttcccgtacaacacgccgacctccaaagaaggctatctgtaccgcgag
atcttcgaagagctgttcccgttgccgagcgcggcggagtgcgtccctggcggtccgtcg
gtggcctgctcttcagcgaaagccattgagtgggatgaagcgttcaaaaccatgaacgat
ccatcaggccgcgcggtcggtgtccaccagtcggcctacaaataa

DBGET integrated database retrieval system