KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_15650Help
Entry
KPHS_15650        CDS       T01733                                 

Definition
succinate dehydrogenase cytochrome b556 small membrane subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KPHS_15650
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KPHS_15650
   00650 Butanoate metabolism
    KPHS_15650
  Energy metabolism
   00190 Oxidative phosphorylation
    KPHS_15650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1629287..1629634
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATTGEISWEVWTGFFASGFTKVF
TLLALVSILIHAWIGMWQVLTDYVKPLALRLVLQLAIVVALVAYVLYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctcagcactgggacgcaacggcgtacatgactttatcctggtccgt
gctaccgccatcgttctgaccctctacatcatctacatggttggcttcttcgccaccacc
ggtgaaatctcatgggaagtgtggaccggattctttgcctccggcttcactaaagtcttc
actctgctggctctcgtttccattctcatccatgcctggatcgggatgtggcaggtgtta
acagactacgttaaaccactggctctgcgcctggttctgcaactggctatcgttgtggcg
ctggtggcttacgttctttatggatttgttgtggtgtggggtgtgtaa

DBGET integrated database retrieval system