KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_15650Help
Entry
KPHS_15650        CDS       T01733                                 

Definition
(RefSeq) succinate dehydrogenase cytochrome b556 small membrane subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
kpm00020  Citrate cycle (TCA cycle)
kpm00190  Oxidative phosphorylation
kpm00650  Butanoate metabolism
kpm01100  Metabolic pathways
kpm01110  Biosynthesis of secondary metabolites
kpm01120  Microbial metabolism in diverse environments
kpm01130  Biosynthesis of antibiotics
kpm01200  Carbon metabolism
Module
kpm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kpm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
kpm_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KPHS_15650
   00650 Butanoate metabolism
    KPHS_15650
  Energy metabolism
   00190 Oxidative phosphorylation
    KPHS_15650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Fumarate_red_C CbtB
Motif
Other DBs
NCBI-GeneID: 11846573
NCBI-ProteinID: YP_005225865
UniProt: A0A0H3GLI5
Position
1629287..1629634
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATTGEISWEVWTGFFASGFTKVF
TLLALVSILIHAWIGMWQVLTDYVKPLALRLVLQLAIVVALVAYVLYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctcagcactgggacgcaacggcgtacatgactttatcctggtccgt
gctaccgccatcgttctgaccctctacatcatctacatggttggcttcttcgccaccacc
ggtgaaatctcatgggaagtgtggaccggattctttgcctccggcttcactaaagtcttc
actctgctggctctcgtttccattctcatccatgcctggatcgggatgtggcaggtgtta
acagactacgttaaaccactggctctgcgcctggttctgcaactggctatcgttgtggcg
ctggtggcttacgttctttatggatttgttgtggtgtggggtgtgtaa

DBGET integrated database retrieval system