KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_15710Help
Entry
KPHS_15710        CDS       T01733                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KPHS_15710
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KPHS_15710
   00640 Propanoate metabolism
    KPHS_15710
   00660 C5-Branched dibasic acid metabolism
    KPHS_15710
Enzymes [BR:kpm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     KPHS_15710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
1636666..1637832
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGLPAPVGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGV
KVVKSKEEIRAFAEHWLGKRLVTYQTDANGQPVNQILVEAATDIDKELYLGAVVDRSSRR
VVFMASTEGGVEIEKVAEETPHLIHKIAIDPLAGPMPYQGRELAFKLGLEGKQVQQFTKI
FMGLATIFLERDLALIEINPLVITKQGDLICLDGKLGADGNALFRQPDLREMRDQSQEDP
REAQAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGEPANFLDVGGGATKERVTE
AFKIILSDDNVKAVLVNIFGGIVRCDLIADGIIGAVAEVGVNVPVVVRLEGNNAELGAKK
LADSGLNIIAAKSLTDAAQQVVAAVEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacatgaatatcaggcaaaacaactttttgcccgctatggcttaccggcgccg
gtgggttatgcctgtactactccgcgtgaagcagaagaagccgcttcaaaaatcggcgcg
ggtccgtgggtagtgaaatgtcaggttcacgctggtggccgcggcaaagcgggcggtgtg
aaagtagttaagagcaaagaagagatccgcgcatttgccgagcactggctgggcaaacgt
ctggtgacctatcaaacagatgcgaacggccagccggttaaccagatcctggttgaagcg
gcgaccgatattgacaaagagctgtacctgggcgcggttgttgaccgtagctcccgtcgc
gtggtgttcatggcgtctaccgaaggcggcgtggaaatcgagaaagtggcggaagagacc
ccgcacctgatccacaagatcgccatcgatccgctggcgggcccgatgccttaccagggt
cgtgaactggcgttcaaactgggtctggaaggtaaacaggttcagcagttcaccaagatt
ttcatgggtctggcgaccattttccttgagcgcgacctggcgctgatcgagatcaacccg
ctggtgatcaccaagcagggcgacctgatctgcctcgacggcaaactgggcgctgacggc
aacgcgctgttccgccagccggatctgcgcgaaatgcgcgatcagtctcaggaagaccca
cgtgaagcgcaggcggcgcagtgggaactgaactacgtcgcgctggacggcaacatcggc
tgcatggttaacggcgcaggcctggcgatgggtaccatggacatcgttaagctgcacggc
ggcgaaccggctaacttcctcgacgtaggcggcggcgcgaccaaagagcgcgtgaccgaa
gcgttcaaaatcatcctctctgacgacaacgttaaagcggtgctggttaacatcttcggc
ggcatcgtgcgttgcgacctgatcgctgacggcatcatcggcgcggtagcggaagtaggg
gttaacgttccggttgttgtacgtctggaaggtaacaacgccgaactgggcgcgaaaaaa
ctggctgacagcggcctgaatattattgcagcgaaaagtctgacggacgcagcacagcag
gttgttgccgcagtggaggggaaataa

DBGET integrated database retrieval system