KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_15910Help
Entry
KPHS_15910        CDS       T01733                                 

Definition
(RefSeq) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
kpm00010  Glycolysis / Gluconeogenesis
kpm00260  Glycine, serine and threonine metabolism
kpm00680  Methane metabolism
kpm01100  Metabolic pathways
kpm01110  Biosynthesis of secondary metabolites
kpm01120  Microbial metabolism in diverse environments
kpm01130  Biosynthesis of antibiotics
kpm01200  Carbon metabolism
kpm01230  Biosynthesis of amino acids
Module
kpm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
kpm_M00002  Glycolysis, core module involving three-carbon compounds
kpm_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPHS_15910
  Energy metabolism
   00680 Methane metabolism
    KPHS_15910
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KPHS_15910
Enzymes [BR:kpm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     KPHS_15910
Membrane trafficking [BR:kpm04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    KPHS_15910
Exosome [BR:kpm04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   KPHS_15910
  Exosomal proteins of melanoma cells
   KPHS_15910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 11846606
NCBI-ProteinID: YP_005225891
UniProt: A0A0H3GU79
Position
complement(1654782..1655534)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGVSEAKAAGKLLKAEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLTDAELPTTESLALTIDRVVPYWNETILPRLKSGERVI
IAAHGNSLRALVKYLDNMGEDEILELNIPTGVPLVYEFDENFKPIKHYYLGNAEEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggtactggttcgtcatggcgaaagccagtggaacaacgaaaac
cgcttcaccggttggtacgacgtggatctgtccgagaaaggcgttagcgaagcaaaagca
gcgggtaaactgctgaaggctgaaggcttcagctttgattttgcttatacctccgtgctg
aaacgtgccatccacaccctgtggaacgtgctggacgaactggatcaggcctggctgccg
gttgagaaatcctggaagctgaacgagcgtcattacggcgcgctgcagggcctgaacaaa
gcggaaaccgctgagaaatatggtgacgagcaggttaaacagtggcgtcgcggcttcgct
gtcactccgccggagctgaccaaagacgacgagcgctacccgggccacgatccgcgctat
gcaaaactgaccgacgccgaactgccgaccactgaaagcctggcgctgactatcgaccgc
gtcgtgccttactggaacgaaaccattctgccgcgcctgaaaagcggtgagcgcgtgatc
atcgccgctcacggtaactccctgcgcgcgctggtgaaatacctcgacaacatgggcgaa
gacgagatcctcgaactgaacatcccgaccggcgtaccgctggtatatgagttcgatgaa
aacttcaagccgatcaaacattactatctgggcaacgcggaagagatcgcggcgaaagcg
gctgccgtcgccaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system