KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_15910Help
Entry
KPHS_15910        CDS       T01733                                 

Definition
(RefSeq) phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KPHS_15910
   01230 Biosynthesis of amino acids
    KPHS_15910
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPHS_15910
  Energy metabolism
   00680 Methane metabolism
    KPHS_15910
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KPHS_15910
Enzymes [BR:kpm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     KPHS_15910
Exosome [BR:kpm04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   KPHS_15910
  Exosomal proteins of melanoma cells
   KPHS_15910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1654782..1655534)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGVSEAKAAGKLLKAEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLTDAELPTTESLALTIDRVVPYWNETILPRLKSGERVI
IAAHGNSLRALVKYLDNMGEDEILELNIPTGVPLVYEFDENFKPIKHYYLGNAEEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggtactggttcgtcatggcgaaagccagtggaacaacgaaaac
cgcttcaccggttggtacgacgtggatctgtccgagaaaggcgttagcgaagcaaaagca
gcgggtaaactgctgaaggctgaaggcttcagctttgattttgcttatacctccgtgctg
aaacgtgccatccacaccctgtggaacgtgctggacgaactggatcaggcctggctgccg
gttgagaaatcctggaagctgaacgagcgtcattacggcgcgctgcagggcctgaacaaa
gcggaaaccgctgagaaatatggtgacgagcaggttaaacagtggcgtcgcggcttcgct
gtcactccgccggagctgaccaaagacgacgagcgctacccgggccacgatccgcgctat
gcaaaactgaccgacgccgaactgccgaccactgaaagcctggcgctgactatcgaccgc
gtcgtgccttactggaacgaaaccattctgccgcgcctgaaaagcggtgagcgcgtgatc
atcgccgctcacggtaactccctgcgcgcgctggtgaaatacctcgacaacatgggcgaa
gacgagatcctcgaactgaacatcccgaccggcgtaccgctggtatatgagttcgatgaa
aacttcaagccgatcaaacattactatctgggcaacgcggaagagatcgcggcgaaagcg
gctgccgtcgccaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system