KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_15920Help
Entry
KPHS_15920        CDS       T01733                                 

Definition
(RefSeq) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
kpm00010  Glycolysis / Gluconeogenesis
kpm00052  Galactose metabolism
kpm01100  Metabolic pathways
kpm01110  Biosynthesis of secondary metabolites
kpm01120  Microbial metabolism in diverse environments
kpm01130  Biosynthesis of antibiotics
Module
kpm_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPHS_15920
   00052 Galactose metabolism
    KPHS_15920
Enzymes [BR:kpm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     KPHS_15920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 11846607
NCBI-ProteinID: YP_005225892
UniProt: A0A0H3GK63
Position
complement(1655826..1656869)
Genome map
AA seq 347 aa AA seqDB search
MLTQTTALAPDGRPWQQVTLRNKSGMTVTVADWGATLLSAEVPLADGSLRRPLLGCAKLE
DYARQAAFLGASVGRYANRIGHSRFPLDGQVVNVTPSNDAGHQLHGGPEGFDKRRWRIVR
ADEQEVLFALTSPDGDQGFPGTLQATAHYRLTDDNRIAITYRATVDQPCPVNMTNHVYFN
LDGEQGDVRQHQLQILAQRYLPVESDGIPGGELKDVANTSFDFRQPKTIAADFLADADQQ
KVKGYDHAFLLDAKGDASQPAAQVWSQDGKLQMTVYTSAPALQFYSGNYLGGTPSQTTEP
YADWQGLALESEFLPDSPNHPQWPQPDCVLRPGQEYVSLTEYQFIAR
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgctaacgcaaaccaccgcgctggccccggacggccggccatggcagcaggtgaccctg
cgcaataagtcggggatgaccgtcaccgtggcggactggggcgcgacgctgctcagcgcc
gaggtgccgctggccgatggcagcctgcgccgaccgctgctgggctgcgcaaagctggaa
gactatgctcgccaggccgcatttcttggcgcctcggtaggccgctacgccaaccgtatc
ggccacagccgcttcccgcttgacggccaggtcgtcaacgtcacgccgtcaaacgacgcg
ggccaccagctccacggcggcccggaagggtttgataagcgccgctggcgcattgtccgc
gccgacgagcaggaagtgctgttcgccctgacctcgcccgatggcgatcaaggctttccg
ggcaccctgcaggccaccgcgcactatcgtctgaccgacgataaccgcatcgcgattacc
tatcgcgccaccgtggaccaaccctgcccggtgaatatgaccaatcacgtctatttcaac
ctcgacggtgagcagggcgatgtgcgccagcatcagctccagatcctcgcccagaggtat
ctgccggtggaaagcgacggtatcccgggtggcgaactgaaagatgttgctaacaccagc
tttgatttccgccagccgaaaaccatcgccgccgacttcctcgcggatgccgatcagcaa
aaggtgaagggatacgatcatgccttcctgctggatgccaaaggcgacgccagccagcct
gcggcacaggtctggtcgcaggatggcaagctgcagatgacggtctatacctccgctccg
gcgctgcagttttactccggcaactatctcggcggcaccccgtcgcagacgacggagccc
tacgccgactggcagggactggcgctggagagcgaattcctgccggattcgccgaaccat
ccgcaatggccgcagccggactgtgtattacgtccgggccaggagtacgtcagcctgacg
gaatatcagtttatcgcccgataa

DBGET integrated database retrieval system