KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_16170Help
Entry
KPHS_16170        CDS       T01733                                 

Definition
putative pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    KPHS_16170
   00500 Starch and sucrose metabolism
    KPHS_16170
Enzymes [BR:kpm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     KPHS_16170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1674940..1676223)
Genome map
AA seq 427 aa AA seqDB search
MNTYSVSRLALALAFGVTLSACSSTPADQQPSTQTAPGTTARPILNAEEAKNFTPAAYFQ
SLAPNAAAWTPSAISLPAQPDFIVGPAGTQGVTHTTIQAAVDAAIARHSNRRLYIAIMPG
EYPGTVYVPAAPGALTLYGTGDKPIDVKISEAIDSEMDRNTWRRLVNPGGKYMPGKPAWY
MFDSCQSKSAATIGVMCSAVFWSQNNGLQLQNLTIANNLGDSVDAGTHQAVALRSDGDQV
QINKVNILGRQNTFFVTNSGVQNRLQDNRQTRTLVTNSYIEGDVDIVSGRGAVVFDNTDF
RVVNSRTQKEAYVFAPATLKSVTYGFLATNSRFTASGDNVAQLGRALDVDGNSNGQVVIR
DSAINEGFNIAQPWAAAVGSGRPFSGNTGSADDKGNLQRNLNDNGFNRMWEYNNRGVGST
VVAEPKQ
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaacacatattccgtttcccgtctggcgctggcgctggccttcggcgtgacgctgtcc
gcctgtagctcgacgcctgccgatcaacagccctcaacgcagactgcaccgggcactacc
gcgcgtcccatactcaacgccgaagaagcgaaaaacttcacgccggcggcctatttccag
tcgctggctcccaacgccgccgcctggacgccgtctgccatcagcctgccggcgcagcct
gactttatcgtcggccctgcgggaacccagggcgtaacccataccaccattcaggcggcg
gtggatgcggcaattgcccgtcactctaaccgtcgtctgtatatcgcgattatgccgggc
gagtaccctggaaccgtctacgttccggcggcgccgggcgccctgaccctgtatggtact
ggcgataagccaatcgacgtgaaaatcagcgaagccattgattccgagatggatcgcaac
acctggcgtcgtctggtcaatccaggcggtaaatatatgccgggtaaaccggcgtggtat
atgttcgacagttgccaaagcaaatccgcggcgaccatcggcgtaatgtgttccgcagtc
ttctggtcacagaataatggtctgcagctgcagaacctgaccatcgccaacaacctcggc
gacagcgttgacgccggtacccaccaggcggtggcattgcgcagcgatggcgaccaggtg
cagatcaataaggtcaatattcttggccgtcagaacaccttcttcgtgaccaacagcggc
gtgcaaaaccgtctgcaggacaaccgtcagacccgcaccctggtgaccaacagctacatt
gaaggcgatgtggatatcgtttccggccgcggcgcggtggtgtttgataacaccgatttc
cgcgtggtgaattcccgtacccagaaagaggcctacgtcttcgcgccggctactctgaag
agcgtgacctacggcttcctggcgaccaacagccgcttcaccgcctccggggataacgtc
gcgcagctcggccgcgcgctggatgtcgatggcaatagcaacggccaggtggtgatccgc
gacagcgctatcaatgaaggctttaatattgcccagccgtgggcggcggcggtaggctcc
ggccgcccgttcagcggcaacaccggcagcgccgatgacaaaggcaatctgcagcgcaac
ctcaacgacaacggcttcaaccgcatgtgggagtacaataaccgcggcgtgggaagcacc
gtggtcgccgagccgaaacagtaa

DBGET integrated database retrieval system