KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_16940Help
Entry
KPHS_16940        CDS       T01733                                 

Definition
molybdopterin biosynthesis protein
Orthology
K03750  
molybdopterin molybdotransferase [EC:2.10.1.1]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Brite
Enzymes [BR:kpm01000]
 2. Transferases
  2.10  Transferring molybdenum- or tungsten-containing groups
   2.10.1  Molybdenumtransferases or tungstentransferases with sulfide groups as acceptors
    2.10.1.1  molybdopterin molybdotransferase
     KPHS_16940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1755320..1756555)
Genome map
AA seq 411 aa AA seqDB search
MDFTAGLMPLDTALAQMLDRITPLNATETVPLLQAFSRVTAHDIVSPLDVPGFDNAAMDG
YAVRLNDLRDGAALPVAGKAFAGQPFNDAWPSGTCIRIMTGAPVPEGCDALVMQEETEQT
EAGVRFIAPVKAGQHIRRRGEDIAQGAVVFPAGTPLTVAELPVLASLGIAEVEVVRKVRV
AVFSTGDELQLPGQPLGDGQIYDTNRLAVHLMLQQLGYEVINLGIIPDDPAKLRDAFIAA
DQQADVVISSGGVSVGEADYTKTILEELGEIGFWKLAIKPGKPFAFGKLSSSWFCGLPGN
PVSATVTFCQLVQPLLAKLSGKHGPLQAPRLRVRAATRLKKSPGRLDFQRGILQRNPDGE
LVVNTTGHQGSHIFSSFSLGNCFIVLERERGHVEAGEWVEVEPFSHLFGGL
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggattttaccgccggactgatgccgctcgacacagccctcgcccagatgctcgatcgt
attacgccgctgaacgcgacggaaactgtaccgctgttgcaggccttctcgcgtgtgacc
gcccatgacatcgtctccccgctggacgtgcccggctttgataacgcggcgatggatggc
tatgccgtccggctgaacgaccttcgcgacggcgccgcgctgccggtcgccggtaaggcc
ttcgccggccagccgttcaacgacgcctggccgtcgggcacctgtatccgcatcatgacc
ggcgcgccggtgccggaaggctgcgatgcgctggtgatgcaggaagagaccgaacagacc
gaggccggtgtgcgctttatcgcgccggtaaaagccgggcagcatattcgccgccgcgga
gaagatattgcccaaggcgcggtggtcttcccggcggggacacccctgacggtggccgag
ctgccggtgctggcctcgctgggcattgccgaggtcgaggtggtgcgcaaggtacgcgtc
gcggtcttctcaaccggcgatgagctgcagctgccgggtcaaccgctcggcgacggccag
atttacgataccaaccgcctggcagtgcacctgatgctgcagcagttgggctacgaggtc
attaacctgggcattattcctgacgacccggcgaagctgcgcgacgcctttatcgccgcc
gaccagcaggccgatgtggtcattagctcaggcggcgtctcggtgggtgaagccgattac
accaaaactatcctcgaagagctgggggagatcggcttctggaagctggcgattaagccg
gggaaacccttcgccttcggcaagctcagcagcagctggttctgcggcctgccgggtaac
ccggtgtccgccaccgtcaccttctgtcagctggtgcaacccctgctggcgaaactctcg
ggcaagcacggcccgcttcaggcgccccgcctgcgggtccgcgccgccacgcgcctgaaa
aagtcgcctggccgcctcgattttcagcgcggtattctgcagcgtaacccggacggcgaa
ctggtggtgaacaccaccggccatcagggctcgcacattttcagctccttcagcctcggc
aactgctttatcgtgctggagcgtgagcgcggccatgttgaagcaggcgaatgggtcgag
gtcgaacccttcagtcacctgtttggggggctgtaa

DBGET integrated database retrieval system