KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_17270Help
Entry
KPHS_17270        CDS       T01733                                 

Definition
hypothetical protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Brite
Enzymes [BR:kpm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     KPHS_17270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1791209..1791718
Genome map
AA seq 169 aa AA seqDB search
MNPSTVKRCLVGAVLAIAATLPGFQQLHTSMEGLKLIADYEGCRLQPYQCDAGVWTDGIG
NTSGVVPGKTITERQAAGSFITNVLRVEKALDRCVLVSVPQNVYDALVSLAFNVGTGNAC
GSTMVKFINQKRWREACYQLPRWVYVKGVFNPGLDNRRARELSWCLKGA
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgaatccttcaaccgttaaacgctgcctggtaggggcggtgctggcgattgccgccacc
ctgccgggctttcagcaacttcatacctcaatggaagggttgaagctgatagccgattac
gagggctgccgcctgcagccgtatcagtgtgatgcgggggtgtggaccgatggcattggc
aatacgtccggcgtggtgccggggaagaccatcacggaacggcaggccgccgggagtttc
atcaccaacgttttaagggtggagaaggcgctggatcgctgtgtcctggtgagcgtaccg
cagaacgtctatgacgcgctggtatcgctggccttcaacgtgggaaccggcaatgcctgc
ggttcaaccatggtgaagtttatcaatcagaagcgctggcgcgaggcctgctatcagttg
ccacgctgggtatacgtcaaaggcgtatttaatccgggactggacaaccgccgcgcgcgg
gagctgtcctggtgcttaaaaggagcgtaa

DBGET integrated database retrieval system