KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_21600Help
Entry
KPHS_21600        CDS       T01733                                 

Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
kpm00260  Glycine, serine and threonine metabolism
kpm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
kpm01100  Metabolic pathways
kpm01110  Biosynthesis of secondary metabolites
kpm01130  Biosynthesis of antibiotics
kpm01230  Biosynthesis of amino acids
Module
kpm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KPHS_21600
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KPHS_21600
Enzymes [BR:kpm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     KPHS_21600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Mic1
Motif
Other DBs
NCBI-GeneID: 11847178
NCBI-ProteinID: YP_005226460
UniProt: A0A0H3GNB7
Position
complement(2207814..2209007)
Genome map
AA seq 397 aa AA seqDB search
MSTLLNPYFGEFGGMYVPQILMPALRQLEEAFVSAQKDPAFQAEFTDLLKNYAGRPTALT
KCRNLTEGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASA
LASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGS
YEKAHYMLGTAAGPHPFPTIVREFQRMIGEETKAQILEKEGRLPDAVIACVGGGSNAIGM
FADFIEETNVGLIGVEPAGHGIESGEHGAPLKHGRVGIYFGMKSPMMQTADGQIEESYSI
SAGLDFPSVGPQHAFLNSTGRADYVSITDDEALDAFKALSRHEGIIPALESSHALAHALK
MMRENPEKEQLLVVNLSGRGDKDIFTVHDILKARGEI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgagcactttactgaacccctacttcggcgaattcggcggcatgtatgtgccgcagatc
ctgatgcccgccctgcgccagctggaagaagcctttgtcagcgcgcagaaggacccggcc
tttcaggcggaattcaccgacctgctgaaaaactacgccggtcgtccgacggccctgacc
aaatgccggaatctgaccgaaggcacccgcaccaccctgtacctgaaacgcgaagatctg
ctgcacggcggcgcgcacaaaaccaaccaggtgctgggccaggccctgctggccaaacgg
atgggtaaaaccgaaattatcgccgagaccggcgccggccagcacggcgtcgcctcagcg
ctggccagcgccctgctcggcctgaaatgccgtatctacatgggtgccaaggacgtcgag
cgccagtcgccgaacgtgttccgtatgcgcctgatgggcgccgaggtgatcccggtgcac
agcggctccgccacgctgaaagatgcctgtaacgaggcgctgcgcgactggtccggcagc
tacgaaaaggcgcactatatgctgggcaccgccgccggtccgcacccgttcccgacgatt
gtgcgtgaattccagcgcatgattggcgaagagaccaaagcgcagatccttgaaaaagag
ggccgcctaccggacgcggtgatcgcctgcgtcggcggcggatcaaacgccatcggcatg
ttcgctgattttatcgaggaaaccaacgtcggcctgatcggcgtggagcccgccggacac
ggtatcgagagcggcgagcacggcgcgccgctgaagcatggccgcgttgggatctacttc
ggtatgaagtcgccgatgatgcagaccgccgacggccagatcgaagagtcttactccatt
tccgccgggctggacttcccgtccgttgggccgcagcacgcgtttctgaacagcaccggt
cgcgctgactatgtgtcgatcactgacgacgaagcgctggacgcgtttaaagcgctttcc
cgccacgaagggattatcccggcgctggagtcctctcacgctctggcccacgcgctgaag
atgatgcgcgagaacccggaaaaagagcagctgctggtggttaatctctccggccgcggc
gacaaagacattttcaccgtacatgacatcctgaaagcgcgaggggaaatctga

DBGET integrated database retrieval system