KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_21610Help
Entry
KPHS_21610        CDS       T01733                                 

Definition
(RefSeq) bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
kpm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
kpm01100  Metabolic pathways
kpm01110  Biosynthesis of secondary metabolites
kpm01130  Biosynthesis of antibiotics
kpm01230  Biosynthesis of amino acids
Module
kpm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KPHS_21610
Enzymes [BR:kpm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     KPHS_21610
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     KPHS_21610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-GeneID: 11847179
NCBI-ProteinID: YP_005226461
UniProt: A0A0H3GW36
Position
complement(2209017..2210375)
Genome map
AA seq 452 aa AA seqDB search
MQTVLAKIVADKAIWVEARKQQQPLASFQNEIVPTQRNFYDALAGTRTAFILECKKASPS
KGLIREDFDPAAIASIYKHYASAISVLCDEKYFQGSFDFLPIVSQVAPQPILCKDFTIDP
YQIYLARYYQADACLLMLSVLDDEQYRQLSAVAHSLNMGVLTEVSNEEELERAIALKAKV
VGINNRDLRDMSIDLNRTRQLAARLGPDVTVISESGIHTYAEVRELSHFANGFLIGSALM
EQADLEAAVKRVLLGENKVCGLTRPQDAQVAWESGAIYGGLIFVPTSPRAVNDAQAKAVI
AAAPLQYVGVFRNAPLEEVVARAQALGLAAVQLHGDEDQAYIDALRDALADNVRIWKALS
VGETFPARTLHHVDKYLLDNGQGGSGQRFDWSLLQGQDLRNVMLAGGLGADNCVEAAKSG
CAGLDFNSGVESQPGMKDASKLASVFQTLRAY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccgttttagcaaaaatcgttgccgacaaagcgatttgggtggaagcccgcaaa
caacaacaaccgttagccagttttcaaaatgagatcgttccgacgcagcgcaatttctat
gacgcgctggccggcacccgcaccgcgtttattcttgagtgcaagaaggcctcaccgtcg
aaggggttgattcgcgaggatttcgatccggcagcgatcgccagcatctacaagcactac
gcctcggcgatctcggtgctgtgtgatgagaaatatttccagggcagcttcgatttcctg
ccgatcgtcagccaggtcgcgccgcagccgatcctgtgtaaggacttcaccatcgaccct
taccagatctacctggcgcgctactatcaggccgacgcctgcctgctgatgctctcggtg
ctcgacgatgaacagtatcgtcagctctcggcggtggctcacagcctgaatatgggcgtg
ctgaccgaagtcagcaatgaagaggaactggagcgcgccatcgccctgaaggcgaaggtg
gtgggcattaacaaccgcgacctgcgcgatatgtcgattgaccttaaccgcacccgtcag
ctggcggcgcgtctcggcccggatgtcacggtgatcagcgaatccggcatccatacctat
gccgaagtgcgcgagctgagccacttcgccaacggcttcctgatcggctccgccctgatg
gagcaggcggatctggaagcggcggttaaacgcgtgctgctcggcgagaacaaagtgtgc
ggcctgacgcgcccgcaggatgcccaggtggcctgggagtccggcgccatttacggtggg
ctgatcttcgtcccgacctcgccgcgagcggtgaatgacgcccaggccaaagcggtgatc
gccgctgcgccgctgcagtacgtcggcgtcttccgcaatgcgccgctggaggaggtggtc
gcccgcgcgcaggctctggggctggccgccgtgcagctgcacggtgatgaagaccaggcc
tatatcgacgcgctgcgcgacgccctcgcggacaacgtccgcatctggaaagcgctgagc
gtcggcgaaaccttcccggcccgtacgctccaccatgtcgacaagtacctgctcgacaac
ggccagggcggcagcggccagcgctttgactggagcctgctgcagggccaggatctgcgc
aacgtcatgctggcgggcggcctcggcgccgataactgtgtggaagcggccaaaagcggc
tgtgccggactcgatttcaattcaggcgtagagtcgcaaccagggatgaaagacgccagc
aagctggcctccgtattccagacgctgcgcgcatattaa

DBGET integrated database retrieval system