KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_22610Help
Entry
KPHS_22610        CDS       T01733                                 

Definition
hypothetical protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2296377..2296907
Genome map
AA seq 176 aa AA seqDB search
MANLKTKLSSAMLALIAAGASAPVLMDQFLNEKEGKSLTSYRDGAGIWTICRGVTQVDGR
PVTQGMKLTQAKCDQVNAVERNKALAWVDQNVRVPLTPPQKVGIASFCPYNIGPGKCFPS
TFYRKLNAGDRKGACAEIRRWIFDGGKDCRVRSNNCYGQVSRRDQESALACWGIDE
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atggctaacctgaaaacgaaactcagttcggccatgctggcgcttatcgctgctggcgct
tcagctcccgttcttatggaccagttcctgaatgagaaagagggcaaaagcctcacgtca
taccgcgatggcgccggcatatggacgatatgtcgtggagttacccaggtagatggaaga
cctgtaacccagggaatgaagttaacccaggccaaatgcgatcaggttaatgccgtcgag
cgcaataaggcgctggcatgggtagatcagaatgtgcgtgttcctctgacaccccctcaa
aaggtcgggattgccagtttctgcccctataacatcgggcccggtaaatgctttccttcc
accttctaccgcaagctgaatgccggtgaccggaaaggcgcctgcgctgaaattcgccgg
tggatttttgatggcggaaaagattgccgcgtgcgttcgaacaattgttacggccaggtc
tctcgtcgtgatcaggaaagcgcactggcatgttgggggatagatgaatga

DBGET integrated database retrieval system