KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_28230Help
Entry
KPHS_28230        CDS       T01733                                 

Definition
(RefSeq) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
kpm00010  Glycolysis / Gluconeogenesis
kpm00071  Fatty acid degradation
kpm00350  Tyrosine metabolism
kpm00625  Chloroalkane and chloroalkene degradation
kpm00626  Naphthalene degradation
kpm01100  Metabolic pathways
kpm01110  Biosynthesis of secondary metabolites
kpm01120  Microbial metabolism in diverse environments
kpm01130  Biosynthesis of antibiotics
kpm01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPHS_28230
  Lipid metabolism
   00071 Fatty acid degradation
    KPHS_28230
  Amino acid metabolism
   00350 Tyrosine metabolism
    KPHS_28230
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    KPHS_28230
   00626 Naphthalene degradation
    KPHS_28230
Enzymes [BR:kpm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     KPHS_28230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 CoA_binding Methyltransf_25 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 11847841
NCBI-ProteinID: YP_005227123
UniProt: A0A0H3GTY9
Position
2822058..2823068
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTHDHQVNVTEKTLRPLEYGEALLKMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGVVQKVGPGVTSLKPGDRASVAWFFEGCGHCDYCNSGNETLCRSVKNAGYTVDGGMAEE
CIVTANYAVKVPDGLDSAAASSITCAGVTTYKAVKVSHIKPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDGQLELAASMGADLTINSRNEDAAKVIQEKTGGAHAAVVTAVAKA
AFNSAVDAVRAGGRVVAVGLPPEAMSLDIPRLVLDGIEVVGSLVGTRQDLVEAFQFAAEG
KVVPKVTLRPLEDINAIFKEMEQGQIRGRMVIDLRS
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagctgttgttacccacgaccatcaggttaacgtcacggaaaaaacgctgcgc
ccgctggaatacggcgaagcgctgttgaaaatggaatgctgcggcgtgtgtcatactgac
ctgcacgtgaaaaacggcgattttggcgataaaaccggcgtcattctcggccatgaaggg
atcggggtggtacaaaaagtcggcccgggcgtcacctccctgaagccgggcgaccgcgcc
agcgtggcgtggttcttcgaaggctgcggccactgcgattactgtaacagcggcaacgag
acgctctgccgctcggtgaaaaacgccggctataccgtcgatggcggcatggcggaagag
tgcatcgtcaccgccaactacgcggtaaaagttccggacggcctcgactccgccgccgcc
agcagcatcacctgcgcgggcgtcaccacctacaaagcggtcaaggtctcccacatcaaa
ccgggccagtggatcgccatctacggcctcggcgggttgggtaacctcgcgctgcagtat
gcgaagaatgtctttaacgccaaagtgatcgctatcgacgtcaacgacggacagctggag
ctggcggcctcgatgggcgccgacctgaccatcaactcccgcaatgaagatgcggcgaaa
gtgattcaggaaaaaaccggcggcgcccacgctgcggtagtaaccgcggtggctaaagcg
gcctttaactcggcggtggatgccgttcgcgccggtggccgcgtggttgcggtgggcctg
ccgccggaggcgatgagcctcgatattccgcgtctggtgctggacggcatcgaggtggtc
ggttcgctggtcggcacccgtcaggatctggtggaagccttccagtttgccgccgaaggc
aaagtggtgccgaaagtcaccctgcgtccgctggaagatatcaatgctatcttcaaagag
atggagcaaggtcagatccgcggccgtatggttatcgatctgcgtagctaa

DBGET integrated database retrieval system