KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_29390Help
Entry
KPHS_29390        CDS       T01733                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:kpm00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2938736..2940106
Genome map
AA seq 456 aa AA seqDB search
MAAFPHNFLWGAATAAYQVEGGHDADGKGPSIWDIYSHLPGTTFEGTTGDIAVDHYHRFR
EDVALMAEMGLQSYRFSISWPRLLPAGRGKVNEAGVQFYSDLIDELLAHNIEPMITLYHW
DLPQALQDEGGWEARTTAEAFAEYARLCYARFGSRVKLWATFNETIVFIGHGYINGLHPP
AVRDPARAIQACHHVFIAHALAVKAFREMAVAGEIGFVNVLQPHTPLTDSEADIKATELA
DAIHTHWLYDPVLKGTYPADLLAQTQALWGVPRFAPGDDALLRDNRCDFIGLNYYRRETV
SAQPPEIATGGEPGVEGLFYFVRNPQSTYTEWGWEIWPQGLTDGIMMIKARYGDIPIYIT
ENGLGAKDPIIDGEVVDDPRIDYLSSHIGALEKALALGADVRGYYPWSFIDLLSWLNGYQ
KQYGFVYVDHQQNLARKRKKSFYWYKSVIASHGEQR
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggccgcttttccgcacaatttcttatggggtgccgctaccgcagcgtatcaggttgag
ggaggacacgacgccgacggtaaaggaccgtcaatctgggatatctactctcatctgccg
ggtaccacctttgaaggcaccaccggcgatattgccgtcgaccactatcaccgttttcgc
gaagacgtggcgttaatggccgaaatgggcctgcaaagctatcgattctccatctcctgg
ccccgcctgctgcccgccgggcgcggtaaggtgaatgaagcgggagtccagttttacagc
gatctgatcgacgaactgctggcgcacaatattgagccgatgatcaccctctatcactgg
gatctgccgcaggccctgcaggatgagggcggctgggaagcgcgcactaccgccgaggcc
ttcgccgagtacgcccgcctgtgctatgcgcgctttggttcacgggtgaagctgtgggct
accttcaacgaaaccattgtcttcattgggcacggctacattaacggcctccatcccccg
gcggtccgcgatccggcgcgtgctattcaggcctgccaccacgtatttatcgcccatgcg
ctggcggtgaaggcctttcgcgagatggctgtggccggcgagattggcttcgtcaacgta
ctgcaaccgcataccccgctcaccgacagcgaggcggacattaaggccaccgaactggct
gacgccatccatactcactggctgtacgatccggtgctgaaaggcacctatcctgccgac
ctgctggcgcagacccaggcgctgtggggggtacctcgctttgctccaggcgacgacgcg
ctgctccgtgacaaccgctgcgactttatcggtctgaattactatcgccgggaaacggta
tctgcccagccgcctgagatcgctaccggcggtgagcctggcgtggagggattattctat
ttcgtgcgtaatccccagagtacatataccgaatggggctgggaaatctggccgcagggg
ctaactgacggcattatgatgattaaggcgcgctatggcgatattccgatatatatcacc
gagaatggcctcggcgcgaaggacccgattattgacggggaagtggtcgacgacccgcgg
attgattatctcagcagccatattggcgccctcgaaaaagcgctggcgctgggggcagat
gtgcgcggctattacccctggtcatttatcgatctgctgagctggctcaacggctatcaa
aagcaatatggttttgtctatgtcgatcaccagcaaaatctggcgcggaaacgaaagaag
agtttttattggtacaaatctgttattgccagtcacggcgaacagcgttaa

DBGET integrated database retrieval system