KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_30340Help
Entry
KPHS_30340        CDS       T01733                                 

Definition
(RefSeq) beta-ketothiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
kpm00071  Fatty acid degradation
kpm00072  Synthesis and degradation of ketone bodies
kpm00280  Valine, leucine and isoleucine degradation
kpm00310  Lysine degradation
kpm00362  Benzoate degradation
kpm00380  Tryptophan metabolism
kpm00620  Pyruvate metabolism
kpm00630  Glyoxylate and dicarboxylate metabolism
kpm00640  Propanoate metabolism
kpm00650  Butanoate metabolism
kpm00900  Terpenoid backbone biosynthesis
kpm01100  Metabolic pathways
kpm01110  Biosynthesis of secondary metabolites
kpm01120  Microbial metabolism in diverse environments
kpm01130  Biosynthesis of antibiotics
kpm01200  Carbon metabolism
kpm01212  Fatty acid metabolism
kpm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KPHS_30340
   00630 Glyoxylate and dicarboxylate metabolism
    KPHS_30340
   00640 Propanoate metabolism
    KPHS_30340
   00650 Butanoate metabolism
    KPHS_30340
  Lipid metabolism
   00071 Fatty acid degradation
    KPHS_30340
   00072 Synthesis and degradation of ketone bodies
    KPHS_30340
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KPHS_30340
   00310 Lysine degradation
    KPHS_30340
   00380 Tryptophan metabolism
    KPHS_30340
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KPHS_30340
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KPHS_30340
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    KPHS_30340
Enzymes [BR:kpm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     KPHS_30340
Exosome [BR:kpm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KPHS_30340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C Ketoacyl-synt_C
Motif
Other DBs
NCBI-GeneID: 11848055
NCBI-ProteinID: YP_005227334
UniProt: A0A0H3GTX8
Position
3021242..3021643
Genome map
AA seq 133 aa AA seqDB search
MRVDKARELGLPVLARIVSSAVAGVDPSVMGIGPVSACRQALQRAGWTLDEVDLIEANEA
FAVQALAVGQLLEWDSEKVNVNGGAIALGHPIGASGCRILVSLVHEMQRRGASKGLATLC
VGGGQGIAMTLQR
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtcgataaagcgcgcgagcttgggctgccggtgctggcgcgcattgtcagctca
gcggtcgccggggtcgacccgtcggtgatgggcatcggcccggtgagcgcctgccgccag
gcgctgcagcgcgccggctggacgctggacgaggtggaccttatcgaagccaacgaggct
tttgccgtccaggcgctggccgtcggccagctgcttgaatgggacagcgagaaggtcaac
gtcaacggcggcgccatcgccctgggccatcccatcggcgcctccggctgccggatcctc
gtcagcctggtgcatgagatgcagcgccggggcgccagcaaagggctggcaaccctgtgc
gtcggcggcggccagggcatcgccatgactctacaacgttaa

DBGET integrated database retrieval system