KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_31000Help
Entry
KPHS_31000        CDS       T01733                                 

Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    KPHS_31000
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KPHS_31000
   00650 Butanoate metabolism
    KPHS_31000
  Amino acid metabolism
   00360 Phenylalanine metabolism
    KPHS_31000
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KPHS_31000
   00622 Xylene degradation
    KPHS_31000
   00621 Dioxin degradation
    KPHS_31000
Enzymes [BR:kpm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     KPHS_31000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3091415..3092365)
Genome map
AA seq 316 aa AA seqDB search
MRKRKVAIIGSGNIGTDLMIKILRHGQHLEMAVMVGIDPQSDGLARARRLGVATTHEGVG
GLMQMAEFADIDFVFDATSAGAHIKNDAALREAKPGIRVIDLTPAAIGPYCVPVVNLADN
LHQGNVNMVTCGGQATIPMIAAVSRVAKVHYAEIVASIASQSAGPGTRANIDEFTETTSQ
AIEKVGGAGKGKAIIVLNPAEPPLMMRDTVYVLSELASQEAIAASIVEMAAAVQAYVPGY
RLKQQVQFEVIPEDRPVNLPGVGCFSGLKTAVYLEVEGAAHYLPAYAGNLDIMTSAALAT
AEQMAGAMHSAAGATA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaacgtaaagtcgccattatcggctccgggaatatcggcaccgatttaatgatt
aaaatcctgcgccacggccagcatctggagatggcggtgatggtcggcatcgacccgcag
tcggatggcctggcccgcgcccggcgcctgggcgttgcgaccactcacgaaggggtgggc
ggcctgatgcagatggcggaatttgccgacatcgattttgtttttgacgccaccagcgcc
ggggcgcacatcaaaaacgatgccgcgctgcgcgaagcgaagccggggatccgcgttatc
gacctgacgccggcggcgattggcccgtactgcgtaccggtggtcaacctcgcggacaat
ctccatcagggcaacgtcaatatggtgacctgcggcgggcaagcgaccatcccgatgatc
gccgcggtctcgcgagtggcgaaggtgcattacgcggagattgtggcctcgatcgccagt
caatccgccgggccgggcacgcgggccaatattgacgaattcaccgaaaccacctcgcag
gcgattgaaaaagtcggcggggcgggcaagggcaaagcgattattgtactgaacccggcg
gagccgccgctgatgatgcgcgataccgtctacgtcctgagcgagctggcgtcgcaggag
gccattgccgcctcgatcgtcgaaatggcggcggcagtgcaggcttacgtcccaggctac
cggctgaagcagcaggtgcagtttgaggttatccccgaggacaggccggtcaacctgccc
ggcgtcggctgtttttccggcctgaaaaccgcggtttacctcgaagtggaaggggcggcg
cactatctgccagcgtacgcgggcaacctcgatattatgacctcggcggcgctggcgacg
gcggagcaaatggccggggcaatgcacagcgcggcgggagcgacagcatga

DBGET integrated database retrieval system