KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_31000Help
Entry
KPHS_31000        CDS       T01733                                 

Definition
(RefSeq) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
kpm00360  Phenylalanine metabolism
kpm00362  Benzoate degradation
kpm00620  Pyruvate metabolism
kpm00621  Dioxin degradation
kpm00622  Xylene degradation
kpm00650  Butanoate metabolism
kpm01100  Metabolic pathways
kpm01120  Microbial metabolism in diverse environments
kpm01220  Degradation of aromatic compounds
Module
kpm_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KPHS_31000
   00650 Butanoate metabolism
    KPHS_31000
  Amino acid metabolism
   00360 Phenylalanine metabolism
    KPHS_31000
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KPHS_31000
   00622 Xylene degradation
    KPHS_31000
   00621 Dioxin degradation
    KPHS_31000
Enzymes [BR:kpm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     KPHS_31000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh F420_oxidored GFO_IDH_MocA Shikimate_DH
Motif
Other DBs
NCBI-GeneID: 11848121
NCBI-ProteinID: YP_005227400
UniProt: A0A0H3GR43
Position
complement(3091415..3092365)
Genome map
AA seq 316 aa AA seqDB search
MRKRKVAIIGSGNIGTDLMIKILRHGQHLEMAVMVGIDPQSDGLARARRLGVATTHEGVG
GLMQMAEFADIDFVFDATSAGAHIKNDAALREAKPGIRVIDLTPAAIGPYCVPVVNLADN
LHQGNVNMVTCGGQATIPMIAAVSRVAKVHYAEIVASIASQSAGPGTRANIDEFTETTSQ
AIEKVGGAGKGKAIIVLNPAEPPLMMRDTVYVLSELASQEAIAASIVEMAAAVQAYVPGY
RLKQQVQFEVIPEDRPVNLPGVGCFSGLKTAVYLEVEGAAHYLPAYAGNLDIMTSAALAT
AEQMAGAMHSAAGATA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaacgtaaagtcgccattatcggctccgggaatatcggcaccgatttaatgatt
aaaatcctgcgccacggccagcatctggagatggcggtgatggtcggcatcgacccgcag
tcggatggcctggcccgcgcccggcgcctgggcgttgcgaccactcacgaaggggtgggc
ggcctgatgcagatggcggaatttgccgacatcgattttgtttttgacgccaccagcgcc
ggggcgcacatcaaaaacgatgccgcgctgcgcgaagcgaagccggggatccgcgttatc
gacctgacgccggcggcgattggcccgtactgcgtaccggtggtcaacctcgcggacaat
ctccatcagggcaacgtcaatatggtgacctgcggcgggcaagcgaccatcccgatgatc
gccgcggtctcgcgagtggcgaaggtgcattacgcggagattgtggcctcgatcgccagt
caatccgccgggccgggcacgcgggccaatattgacgaattcaccgaaaccacctcgcag
gcgattgaaaaagtcggcggggcgggcaagggcaaagcgattattgtactgaacccggcg
gagccgccgctgatgatgcgcgataccgtctacgtcctgagcgagctggcgtcgcaggag
gccattgccgcctcgatcgtcgaaatggcggcggcagtgcaggcttacgtcccaggctac
cggctgaagcagcaggtgcagtttgaggttatccccgaggacaggccggtcaacctgccc
ggcgtcggctgtttttccggcctgaaaaccgcggtttacctcgaagtggaaggggcggcg
cactatctgccagcgtacgcgggcaacctcgatattatgacctcggcggcgctggcgacg
gcggagcaaatggccggggcaatgcacagcgcggcgggagcgacagcatga

DBGET integrated database retrieval system