KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_31600Help
Entry
KPHS_31600        CDS       T01733                                 

Definition
vitamin B12 ABC transport system periplasmic component
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    KPHS_31600
  Metabolism of other amino acids
   00480 Glutathione metabolism
    KPHS_31600
Enzymes [BR:kpm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     KPHS_31600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3148552..3149103)
Genome map
AA seq 183 aa AA seqDB search
MQHDILNTEVTTIDGEKTTLASFAGKVLLIVNVASKCGLTPQYEQLEDLQKQFAAEGFSV
LGFPCNQFLGQEPGSEEEIKTFCSTTYGVTFPLFSKIDVNGEHRAPLYQKLIAAAPKAVA
PEGSGFYERMASKGRAPLYVDDILWNFEKFLIDRQGNVIQRFSPDMTPDDPQLVAAIKGA
LAQ
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcaacatgacattctgaataccgaagtgacgaccattgatggcgagaaaaccaccctg
gcatcctttgccggcaaggtgctgctgatcgtcaatgtggcctcgaaatgcggcctgacg
ccgcagtatgagcaactcgaggatctgcaaaagcagtttgccgccgagggcttcagcgtg
ctggggttcccctgcaaccagttcctcggccaggagccgggcagtgaagaggagattaag
accttctgcagcaccacctacggcgtcaccttcccgctgtttagcaaaattgacgtcaac
ggtgaacatcgcgcgccgctctatcaaaaactgattgccgccgcgccgaaagcggtggcc
ccggaaggcagcggtttttatgagcggatggccagcaaaggccgggcgccgctgtatgtg
gacgacattctgtggaacttcgaaaaattcctcatcgatcgccagggcaacgtcattcag
cgcttctcgccggatatgacgccggatgatccgcagctggtggcggcgattaaaggagcg
ctggcgcaataa

DBGET integrated database retrieval system