KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_31750Help
Entry
KPHS_31750        CDS       T01733                                 

Definition
6-phosphofructokinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KPHS_31750
   01230 Biosynthesis of amino acids
    KPHS_31750
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPHS_31750
   00030 Pentose phosphate pathway
    KPHS_31750
   00051 Fructose and mannose metabolism
    KPHS_31750
   00052 Galactose metabolism
    KPHS_31750
  Energy metabolism
   00680 Methane metabolism
    KPHS_31750
Enzymes [BR:kpm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     KPHS_31750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3164841..3165773
Genome map
AA seq 310 aa AA seqDB search
MTKIYTLTLAPSLDSATQTPQIYPEGKLRCSAPVFEPGGGGINVARAVTFLGGKATAIFP
VGGATGEHLAALLADEQVPVETVETRDWTRQNLHVHVAASGEQYRFVMPGAALTDDEFRR
LEEKVLTIEPGSLLVVSGSLPPGISVDNLMQLVKNAQQQGLRCIIDSSGDALAAALDVGN
IELVKPNQKELSALVQRDLSQPDDVRLAAQSLIQSGKVRRVVVSLGPQGALGVDASGSVQ
VVPPPMKSQSTVGAGDSMVGAMTLRLAENASLEDMVRFGVAAGSAATINQGTRLCSRANT
QKIYDYLCGR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaatttacacgctcacgctggccccctcgctggatagcgccacgcaaacccca
cagatctacccggaaggcaaacttcgctgcagcgcgccggtatttgaacctggcggcggc
gggatcaacgtggcccgcgccgtgacctttctcggcggcaaagccaccgccattttcccg
gtcggtggcgctaccggcgagcatcttgccgccctgctggccgatgagcaggtgccggtc
gagaccgtcgaaacccgcgactggacgcggcaaaacctgcacgtccacgtggccgccagc
ggcgaacagtatcgcttcgttatgcccggcgcggcactgacggacgatgaattccgccgt
ctggaagagaaggttctgactatcgaacccggctctctgctggtggtcagcggcagcctg
ccgccaggtattagcgtcgataacctgatgcagctggtgaaaaatgcgcaacagcaggga
ctgcgctgcatcattgacagttccggcgatgcgctggccgccgcgctggacgtcggcaat
attgagctggtgaaaccgaaccagaaagagcttagcgccctcgtgcagcgcgatctcagc
caacccgatgacgtgcgccttgccgctcagtcgttgatccagtccggtaaagtgcgccgg
gtggtggtctccctgggtccgcagggggcattaggcgtggacgccagcggcagcgttcag
gtagtgccgccaccgatgaaaagccagagcaccgtcggcgctggcgacagcatggtgggc
gccatgaccttgcgtctggcggaaaacgccagccttgaagacatggtacgctttggcgtc
gccgccggtagcgccgcgaccatcaaccagggcacccgcctctgctcgcgggccaatacg
caaaaaatctatgattatctctgcgggcgttga

DBGET integrated database retrieval system