KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_31990Help
Entry
KPHS_31990        CDS       T01733                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase subunit GalU
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    KPHS_31990
   00052 Galactose metabolism
    KPHS_31990
   00500 Starch and sucrose metabolism
    KPHS_31990
   00520 Amino sugar and nucleotide sugar metabolism
    KPHS_31990
Enzymes [BR:kpm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     KPHS_31990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3185329..3186231)
Genome map
AA seq 300 aa AA seqDB search
MAALNSKVRKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLEEVQSICPPHVTIMQVRQGLAKGLGHAVL
CAHPVVGDEPVAVILPDVILDEYESDLSRDNLAEMISRFDETGASQIMVEPVEDVTAYGV
VDCKGESLKPGESVPMVGVVEKPKADVAPSNLAVVGRYVLSADIWPLLAKTPPGAGDEIQ
LTDAIDMLIEKETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHKTLGDDFKAWLETAVAK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggctgcccttaattctaaagtcagaaaagcggttatcccggttgcgggattaggcacc
aggatgctgccggccaccaaagcgattccaaaagaaatgctgccgctggtagataagccg
ttaattcagtacgttgttaatgaatgtatcgctgcaggaattactgaaattgttctggta
acgcactcgtcgaaaaactctatcgaaaaccatttcgataccagttttgagctggaagcg
atgctggaaaaacgtgtaaaacgccagctgctggaagaagtgcagtctatttgcccgccg
cacgtgactattatgcaagttcgtcagggcctggcgaaaggtctgggtcacgcggtgctg
tgcgcccatccggtagtgggagatgagccggtcgcggttattctgccagacgttattctg
gatgaatatgaatccgatctgagccgcgataacctcgctgagatgatctctcgcttcgat
gagactggcgccagccagattatggttgaacctgtcgaagacgtaaccgcttatggcgtg
gttgactgcaaaggcgaatccctgaagccgggcgaaagcgtaccgatggtgggcgtggtt
gagaagccaaaagctgacgttgcgccgtccaacctggcggtggtggggcgttatgtcctc
agcgctgatatctggccgctgctggcgaaaacccctccgggcgctggtgatgaaattcag
ctgactgacgccattgatatgctgatcgagaaagaaacggttgaagcttatcatatgaaa
ggcaagagccatgactgcggtaataagcttggctacatgcaggcgtttgtcgaatatggt
attcgtcacaaaacgctgggcgacgattttaaagcctggctggaaacggcggtagcgaag
taa

DBGET integrated database retrieval system