KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_32360Help
Entry
KPHS_32360        CDS       T01733                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:kpm00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3226127..3226975
Genome map
AA seq 282 aa AA seqDB search
MTRWPSPAKLNLFLYITGQRADGYHTLQTLFQFLDYGDTLTIEPRSDGQLRLLTPVAGVP
DEENLIVRAARLLMHAASESDRLPAGSGADISIDKRLPMGGGLGGGSSNAATVLVALNHL
WGCGLSEDELATLGLQLGADVPVFVRGHAAFAEGVGEILTPVEPEEKWYLVAHPGVSIPT
PIIFRDPELPRNTPRRSINTLLNCEFSNDCELIARKRFREVDAALSWLLEYAPSRLTGTG
ACVFAEFNTESAARQVLDTAPAWLNGFVARGVNLSPLKQALL
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgacccgctggccctctcctgcaaaactgaatctgtttttatatatcaccggccagcgg
gccgatggttaccataccctgcaaacgctgtttcagtttctcgattacggcgatacgttg
accatcgaaccgcgtagtgacggccaactgcgcctgctgacgccggtggccggcgtgccg
gacgaggagaatctgatcgttcgcgccgcgcgtctgctgatgcatgccgccagcgaaagc
gatcgcctgccggcgggcagcggcgccgatatcagtatcgataagcgcctgccgatgggc
ggcggcctgggcggtggctcctccaatgccgccaccgtgctggtggcgctcaaccatctg
tggggctgcggtctctcggaagatgagctggcgactcttggccttcagctgggggccgat
gtgccggttttcgtacgcggccatgccgccttcgccgagggggtgggtgaaatactgacg
ccggtagaacccgaggaaaaatggtacctggtggcccacccgggggtcagtattccgacg
ccgatcatttttcgcgatccggagctaccacgaaataccccgcgccggtcaattaatacg
ttattaaattgtgaattcagcaacgattgcgagcttatcgcaagaaaacgttttcgcgag
gttgatgccgcgctttcctggctgttagaatatgcgccgtcacgcctgaccggcacaggg
gcctgtgtgtttgctgaatttaacaccgaatccgctgcccgtcaggtgctggacactgcc
ccggcatggctaaatggctttgtggcgcgcggagttaacctttcgccgctcaagcaggcc
ctgctctga

DBGET integrated database retrieval system