KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_33970Help
Entry
KPHS_33970        CDS       T01733                                 

Definition
Holliday junction DNA helicase motor protein
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    KPHS_33970
Enzymes [BR:kpm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     KPHS_33970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3373979..3374590)
Genome map
AA seq 203 aa AA seqDB search
MIGRLRGIILEKQPPLVLLETAGVGYEVHMPMTCFYELPEAGQEAIVFTHFVVREDAQLL
YGFNNKQERTLFKELIKTNGVGPKLALAILSGMSAQQFVNAVEREEVASLVKLPGIGKKT
AERLIVEMKDRFKGLHGDLFTPAADLVLASPAGPTADDAEQEAVAALVALGYKPQEASRM
VSKIARPDANSETLIREALRAAL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgataggcagactcagaggcatcattctcgaaaaacaacccccgctggtgttgctggaa
acggcgggcgtcggctatgaagtgcatatgccaatgacctgcttctatgagctgccggag
gccgggcaggaggcgatcgtcttcacccactttgtggtgcgtgaagatgcccagctgctg
tatgggtttaacaacaaacaggaacgtaccctgtttaaagagctgattaaaaccaacggc
gtggggcccaagctggcgctggcgatcctctccggcatgtcggcgcagcagttcgtcaac
gccgttgaacgggaagaggtcgcctcgctggtgaagctgccggggattggcaaaaaaacc
gctgaacgtctgatcgttgagatgaaagaccgcttcaaagggctgcacggcgacctgttc
accccggcggccgatctggtgctggcctcgccggcaggcccaacggcggacgatgccgag
caggaagcggttgccgcgctggtcgcgctgggctataaaccgcaggaggccagccggatg
gtcagcaagatcgcgcgtccggacgccaacagtgaaacgctaattcgcgaagcgctgcgc
gctgcgttgtga

DBGET integrated database retrieval system