KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_35740Help
Entry
KPHS_35740        CDS       T01733                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    KPHS_35740
   00052 Galactose metabolism
    KPHS_35740
   00500 Starch and sucrose metabolism
    KPHS_35740
   00520 Amino sugar and nucleotide sugar metabolism
    KPHS_35740
Enzymes [BR:kpm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     KPHS_35740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3580878..3581852)
Genome map
AA seq 324 aa AA seqDB search
MNMANLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEIVLVTHS
SKNAVENHFDTSYELEALLEQRVKRQLLAEVQAICPPGVTIMNVRQAQPLGLGHSILCAR
PVVGDNPFVVVLPDIILDGGTADPLRYNLAAMIARFNETGRSQVLAKRMPGDLSEYSVIQ
TKEPMVAEGQVARIVEFIEKPDEPQTLDSDLMAVGRYVLSADIWAELERTEPGAWGRIQL
TDAIAELAKKPSVDAMLMTGESYDCGKKMGYMQAFVTYGMRNLKEGTKFRESIKKNAGLT
AGVKMSGRAEPFGTPLITLCRNYS
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaatatggcgaatttgaaagcggttattccggtcgcaggactaggcatgcatatgctg
ccggccacaaaggcaattccaaaggagatgctgccgatcgttgataagccaatgattcag
tacatcgttgacgaaatcgtcgccgccgggatcaaagagattgttctggtgacgcactcc
tcgaagaacgcggtggaaaaccacttcgacacatcctacgagctggaagccctgctggaa
cagcgcgtgaagcgccagctgctggcggaagtgcaggccatttgcccgccgggcgtgacc
atcatgaacgtgcgtcaggcgcagccgctgggcctgggccactccatcctctgcgcccgc
ccggtagtcggcgacaacccgtttgtggtggtcctgccggatatcatccttgacggcggc
accgctgacccgctgcgctataacctcgccgctatgatcgcccgctttaacgagaccggc
cgcagccaggtgctggcgaaacgcatgccgggcgatctttccgaatactccgtcatccag
accaaagagccgatggtggctgaaggccaggtggcgcgtatcgtcgagtttattgaaaaa
ccggacgagccgcagactctggactccgatctgatggcggtggggcgctacgtgctgtcg
gcggatatctgggccgaactggaacgtaccgagccgggcgcatggggccgtatccagctg
actgacgccattgccgaactggcgaagaagccgtccgtcgacgcgatgctgatgaccggc
gaaagctacgactgcgggaagaaaatgggctacatgcaggccttcgtcacctacggcatg
cgtaacctgaaagaaggcaccaaattccgcgaaagtattaaaaaaaatgctggcctgaca
gctggcgtaaagatgagcggcagggcagagcctttcggcacgccgctcataacgttatgc
agaaattattcataa

DBGET integrated database retrieval system