KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_36540Help
Entry
KPHS_36540        CDS       T01733                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    KPHS_36540
Enzymes [BR:kpm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     KPHS_36540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3674213..3674881)
Genome map
AA seq 222 aa AA seqDB search
MSSLSKEAVLVHEALVARGLETPMRAPVQEIDNETRKRLITGHMTEIMQLLNLDLSDDSL
METPHRIAKMYVDEIFSGLDYSRFPKITVIENKMKVDEMVTVRDITLTSTCEHHFVTIDG
KATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERLTQQILIALQTLLGTNNVAVSIDAVH
YCVKARGIRDATSATTTTSLGGLFKSSQNTRQEFLRAVRHHN
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcactgagtaaagaagccgtcctcgttcatgaagcgctggtcgctcgtgggctg
gagacgccgatgcgtgcgccagtacaagaaattgataacgaaacacgcaagcgtttgatt
accggtcatatgaccgagattatgcaactgctgaatctggatctgagtgatgacagtctg
atggagaccccgcatcgcatcgccaaaatgtatgtcgatgagatcttctccgggctggat
tattctcgcttcccgaaaatcaccgtcattgaaaacaaaatgaaggtcgatgaaatggtc
accgtgcgcgatatcaccctgaccagcacctgcgaacaccatttcgttaccatcgatggt
aaagcgacggtagcctatatcccgaaagattcggtgatcggcctgtcgaaaatcaaccgc
atcgtgcagtttttcgcccaacgtccgcaggtccaggagcgtctgacgcagcagatcctg
atcgcgctgcagacgctgctcggcaccaacaacgtggcggtatccattgacgcggtgcat
tattgcgtgaaggcgcgcggcattcgcgacgcgaccagcgccaccaccaccacctctctc
ggcggcctgtttaaatccagccagaatacccgccaggaattcctgcgcgcagtacgtcac
cacaactaa

DBGET integrated database retrieval system