KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_37480Help
Entry
KPHS_37480        CDS       T01733                                 

Definition
aminotransferase AlaT
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    KPHS_37480
   01230 Biosynthesis of amino acids
    KPHS_37480
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KPHS_37480
   00290 Valine, leucine and isoleucine biosynthesis
    KPHS_37480
Enzymes [BR:kpm01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     KPHS_37480
    2.6.1.66  valine---pyruvate transaminase
     KPHS_37480
Amino acid related enzymes [BR:kpm01007]
 Aminotransferase (transaminase)
  Class I
   KPHS_37480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3785104..3786321
Genome map
AA seq 405 aa AA seqDB search
MSPIEKSSKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPFGFEAPDEILVDVIR
NLPTAQGYCDSKGLYSARKAIMQHYQARGMRDVTVEDIYIGNGVSELIVQAMQALLNSGD
EMLVPAPDYPLWTAAVSLSSGKAVHYLCDESSDWFPDLDDIRAKITPRTRGIVIINPNNP
TGAVYSKELLQEIVEIARQHNLIIFADEIYDKILYDEAQHHSIAALAPDLLTVTFNGLSK
TYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPAQHAIQTALGGYQSISEFI
IPGGRLYEQRNRAWELINDIPGVSCVKPKGALYMFPKIDAKRFNIHDDQKMVLDFLLQEK
VLLVQGTAFNWPWPDHVRIVTLPREDDLEMAISRFGRFLSGYHQL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtcccccatcgaaaaatccagcaagttagagaacgtctgttatgacatccgcggcccg
gttctgaaagaagccaaacgtcttgaagaagaaggcaataaggttctgaaactgaacatc
ggcaacccggcgccattcggcttcgaggcccctgacgagatcctcgtcgacgtcatccgc
aatttgcctaccgcccagggttactgcgattcgaaaggattgtactcggcgcgtaaagct
atcatgcagcattaccaggcccggggtatgcgcgatgtcacggtggaagacatctatatc
ggcaacggcgtgtccgagctgattgtgcaggcgatgcaggcgctgttaaacagcggcgat
gagatgctggttcccgccccggactacccgctgtggacggcggcggtgtcgctttccagc
ggcaaagcggtgcactatctgtgtgacgaatcctctgactggttcccggatctggacgac
atccgcgcaaaaatcacaccgcgcacccgcgggatcgtgatcattaaccctaacaacccc
accggcgcggtctattccaaagaattgctgcaggagatcgtggagatcgctcgtcagcat
aatctgatcattttcgccgatgaaatttacgacaagatcctctacgacgaagcccagcat
cactctattgccgccctggcgccggacctgctgacggtgacctttaacggattgtcgaaa
acctaccgcgttgccggcttccgtcagggctggatggtgttgaatggcccgaaaaaacac
gcgaagggctatatcgaagggctggagatgctggcttcaatgcgtctgtgcgccaacgtg
ccggcccagcatgctatccagacggcgctgggcggctatcagagcatcagcgaattcatc
atccccggcggacgcctgtatgaacaacgcaaccgcgcctgggagcttatcaacgatatt
ccgggcgtctcctgcgtgaagccaaaaggcgcgctgtatatgttcccgaaaatcgatgcc
aaacgcttcaatattcatgacgaccagaaaatggtgctcgacttcctgctgcaggagaaa
gtcctgctggtgcagggcaccgcctttaactggccgtggccggatcacgtacgcatcgtg
accctgccgcgcgaagacgacctggagatggctatctcccgctttggccgcttcctctcc
ggctaccatcagctttaa

DBGET integrated database retrieval system