KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_38100Help
Entry
KPHS_38100        CDS       T01733                                 

Definition
(RefSeq) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
kpm00010  Glycolysis / Gluconeogenesis
kpm00052  Galactose metabolism
kpm00500  Starch and sucrose metabolism
kpm00520  Amino sugar and nucleotide sugar metabolism
kpm00521  Streptomycin biosynthesis
kpm01100  Metabolic pathways
kpm01110  Biosynthesis of secondary metabolites
kpm01120  Microbial metabolism in diverse environments
kpm01130  Biosynthesis of antibiotics
kpm01200  Carbon metabolism
Module
kpm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
kpm_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPHS_38100
   00052 Galactose metabolism
    KPHS_38100
   00500 Starch and sucrose metabolism
    KPHS_38100
   00520 Amino sugar and nucleotide sugar metabolism
    KPHS_38100
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    KPHS_38100
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    KPHS_38100
Enzymes [BR:kpm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     KPHS_38100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C
Motif
Other DBs
NCBI-GeneID: 11848843
NCBI-ProteinID: YP_005228110
UniProt: A0A0H3GT96
Position
complement(3842604..3843569)
Genome map
AA seq 321 aa AA seqDB search
MTKFALVGDVGGTNARLALCDLASGEISRAKTYSGLDYPSLEAVVRVYLEEHQVTVNEGC
IAIACPITGDWVAMTNHTWAFSIAEMKRNLGFAHLEIINDFTAVSMAIPMLKAEHLIQFG
GSAPVAGKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEGIILEELRAE
LGHVSAERVLSGPGLVNLYRAIVKSDGRLPENLQPREVTERALADSCTDCRRALSLFCVI
MGRFGGNLALTLGTFGGVYIAGGIVPRFLEFFKASGFRGGFEDKGRFKAYVQDIPVYLIV
HDNPGLLGSGAHLRQTLGQVL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaatttgctttagtaggagatgtcggggggaccaacgcccgcctggcgctatgt
gatctggcgagtggagagatctctcgcgcaaagacctattccgggctcgattaccccagt
ctggaggcagtggtgcgcgtctacctcgaggagcaccaggtaacggtcaacgaaggttgt
atcgccatcgcatgcccgattaccggcgactgggtggcgatgaccaaccatacctgggct
ttctctatcgccgaaatgaagcgcaacctcggctttgcccatctggagataattaacgat
tttaccgctgtttcaatggccattccgatgctgaaagctgagcaccttattcagtttggc
ggcagtgcgccggtagcgggcaaaccgatcgccgtttatggcgccgggaccgggctcggc
gtggcgcatctggtccacgttgataagcgttgggtcagcctgccgggcgaaggcggtcat
gttgattttgccccgaacagcgaagaagaagggatcattctggaagagctacgcgccgag
ctggggcatgtttccgcagaacgcgtgctctcaggtcccgggctggtcaacctgtatcgc
gcgattgtcaaatcggacggccgactgccggagaacctgcagccgcgtgaggtgaccgag
cgagcgctggcggacagctgcaccgactgtcgtcgggcgctgtcgctgttctgcgtcatt
atgggacgcttcggcggtaacctggcgctgaccctcgggacgtttggcggggtgtatatc
gccggcggcatcgtgccgcgcttcctggagttctttaaagcctctggtttccgcggcggt
tttgaagacaaaggccgttttaaagcttatgttcaggatatcccggtttacctgattgtg
catgataacccaggcctgctgggctccggtgcgcatctgcgtcagacgctgggccaggtg
ctttaa

DBGET integrated database retrieval system