KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_41800Help
Entry
KPHS_41800        CDS       T01733                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Brite
Enzymes [BR:kpm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     KPHS_41800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4209881..4210480)
Genome map
AA seq 199 aa AA seqDB search
MNQLRTQGIVDERVLEAIALVPREKFVDEAFEHKAWENTALPIGQGQTISQPYMVARMTE
LLTLTPESRVLEIGTGSGYQTAILAHLVHHVCSVERIKSLQWQARRRLKQLDLHNVSTRH
GDGWQGWQARAPFDAIIVTAAPPEIPTALLAQLDDDGVLVLPVGEEHQFLKRIRRRGNEF
IIDTVEAVRFVPLVKGELA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgaatcaactgcgcacgcagggcatcgtcgatgaacgtgtcctcgaggcgatcgcgctg
gtcccgcgcgaaaagtttgttgatgaagcctttgaacataaagcgtgggaaaacaccgcg
ctgccgattggccaggggcagaccatctcccagccgtatatggtggcgcggatgaccgag
ctgctgacgctgacgccggagtcgcgggtgctggagatcggcaccggttccggctaccag
acggccatcctggcgcatctggtgcatcacgtatgctcggtagagcgaattaagagttta
cagtggcaggcgcgtcgtcgcctgaaacaacttgatttacataatgtttcaacccgtcat
ggcgatgggtggcaaggttggcaggcgcgggcgccgtttgatgccattattgtgacggcg
gcgccgccggaaataccgaccgcgctgctggcgcagctggatgatgacggcgtgctggtg
ctgccggtcggcgaagagcatcagtttctcaaacggatccgtcgtcggggcaacgaattt
atcattgataccgtcgaggccgttcgctttgttcccctggtgaagggggagctggcctga

DBGET integrated database retrieval system