KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_42310Help
Entry
KPHS_42310        CDS       T01733                                 

Definition
(RefSeq) L-fuculose phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
kpm00051  Fructose and mannose metabolism
kpm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    KPHS_42310
Enzymes [BR:kpm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     KPHS_42310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-GeneID: 11849279
NCBI-ProteinID: YP_005228531
UniProt: A0A0H3H254
Position
complement(4267421..4268068)
Genome map
AA seq 215 aa AA seqDB search
MERNRLARQIIDTCLEMTRLGLNQGTAGNVSVRYQGGMLITPTGIPYEKLTEDKIVFIDA
DGQHEQGKLPSSEWRFHQAAYQTRPDAQAVVHNHAVHCTAVSILNRPIPAIHYMIAAAGG
NSIPCAPYATFGTRELSEHVAVALKHRKATLLQHHGLIACEASLEKALWLAHEVEVLAQL
YLSTLAITDPVPVLDDEAIAIVLEKFKTYGLRIEE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaaacagactggcccggcagattatcgatacctgcctggaaatgacccgcctg
gggttaaatcaggggaccgccggcaatgtcagcgtgcgctatcagggaggaatgctgatc
acccctaccggtatcccatatgaaaagctgacggaagacaagatcgtctttattgatgcc
gacggccagcatgagcagggaaaactgccctccagcgaatggcgttttcatcaggcggcc
taccagacgcgacccgatgcccaggcggtggtccacaatcacgctgtccattgtacggcg
gtgtcgatcctcaaccggcccatcccggccattcactatatgatcgccgcggccggcggg
aattcgatcccctgcgcgccctatgccaccttcggcacccgcgaactgtctgagcatgtc
gcggtggcgctgaagcaccgcaaagccacgctgctgcagcatcacggcctgatcgcctgc
gaggccagcctggagaaagcgctctggctggcgcatgaagtggaggtcctggcccagctc
tacctcagtacgctggcgattaccgacccggtcccggtgctggatgacgaggcgatcgcc
atcgtgctggagaagttcaaaacctacggattacgcattgaagagtga

DBGET integrated database retrieval system