KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_42310Help
Entry
KPHS_42310        CDS       T01733                                 

Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    KPHS_42310
Enzymes [BR:kpm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     KPHS_42310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4267421..4268068)
Genome map
AA seq 215 aa AA seqDB search
MERNRLARQIIDTCLEMTRLGLNQGTAGNVSVRYQGGMLITPTGIPYEKLTEDKIVFIDA
DGQHEQGKLPSSEWRFHQAAYQTRPDAQAVVHNHAVHCTAVSILNRPIPAIHYMIAAAGG
NSIPCAPYATFGTRELSEHVAVALKHRKATLLQHHGLIACEASLEKALWLAHEVEVLAQL
YLSTLAITDPVPVLDDEAIAIVLEKFKTYGLRIEE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaaacagactggcccggcagattatcgatacctgcctggaaatgacccgcctg
gggttaaatcaggggaccgccggcaatgtcagcgtgcgctatcagggaggaatgctgatc
acccctaccggtatcccatatgaaaagctgacggaagacaagatcgtctttattgatgcc
gacggccagcatgagcagggaaaactgccctccagcgaatggcgttttcatcaggcggcc
taccagacgcgacccgatgcccaggcggtggtccacaatcacgctgtccattgtacggcg
gtgtcgatcctcaaccggcccatcccggccattcactatatgatcgccgcggccggcggg
aattcgatcccctgcgcgccctatgccaccttcggcacccgcgaactgtctgagcatgtc
gcggtggcgctgaagcaccgcaaagccacgctgctgcagcatcacggcctgatcgcctgc
gaggccagcctggagaaagcgctctggctggcgcatgaagtggaggtcctggcccagctc
tacctcagtacgctggcgattaccgacccggtcccggtgctggatgacgaggcgatcgcc
atcgtgctggagaagttcaaaacctacggattacgcattgaagagtga

DBGET integrated database retrieval system