KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_42340Help
Entry
KPHS_42340        CDS       T01733                                 

Definition
L-fucose isomerase
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    KPHS_42340
Enzymes [BR:kpm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.25  L-fucose isomerase
     KPHS_42340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4269978..4271753
Genome map
AA seq 591 aa AA seqDB search
MKKISLPKIGIRPVIDGRRMGVRESLEAQTMNMAKATAALISEKLRHACGARVECVIADT
CIAGMAESAACEEKFSSQNVGVTITVTPCWCYGSETIDMDPLRPKAIWGFNGTERPGAVY
LAAALAAHSQKGIPAFSIYGHDVQDADDTSIPADVEEKLLRFARAGLAVASMKGKSYLSL
GGVSMGIAGSIVDHNFFESWLGMKVQAVDMTELRRRIDQKIYDETELEMALAWADKHFRY
GEDQNAEQYKRNETQSRAVLKESLLMAMCIRDMMQGNPKLAEKGLVEESLGYNAIAAGFQ
GQRHWTDQYPNGDTAEALLNSSFDWNGVREPFVVATENDSLNGVAMLMGHQLTGTAQVFA
DVRTYWSPDAVERVTGQPLTGRAEHGIIHLINSGSAALDGSCQQRDAQGNPTMKPHWEIE
QSEADACLAATEWCPAIHEYFRGGGFSSRFLTEGGVPFTMTRVNIIKGLGPVLQIAEGWS
VALPKAMHDQLDARTNSTWPTTWFAPRLTGKGPFSDVYSVMANWGANHGVLTIGHVGADF
ITLAAMLRIPVCMHNVEEAKIYRPSAWAAHGMDIEGQDYRACQNYGPLYKR
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcagcttaccgaagatcggtattcgtccggtaatcgatggtcgtcgcatg
ggggtccgcgagtcactggaagcgcaaaccatgaacatggcgaaagccaccgccgcgctt
atcagcgagaaactgcgccacgcctgcggcgcccgggtggagtgcgtgattgccgatacc
tgcatcgccggcatggccgagtcggccgcctgtgaagagaaattcagcagccagaacgtc
ggcgtcaccatcaccgtcaccccctgctggtgctacggcagcgaaaccatcgacatggat
ccgctgcgcccgaaggccatctggggctttaacggcaccgagcgtccgggggcggtctat
ctggccgcggcgctggcggcccatagccagaaagggatcccggcgttctccatctacgga
catgacgtgcaggatgccgatgacacgtcgatcccagcggatgtcgaagaaaagctgttg
cgcttcgctcgcgccggcctggctgtcgccagtatgaaagggaaaagctatctgtcgctg
ggcggcgtctcaatgggcatcgccggatctatcgtcgaccacaacttttttgagtcctgg
ctcggcatgaaggtgcaggctgtcgacatgacggagctgcgccggcgaatcgatcaaaaa
atctatgatgaaaccgagctggagatggcgctggcgtgggcggataaacacttccgctac
ggcgaagatcagaacgctgagcagtataagcgcaatgaaacgcagagccgcgcggtgctg
aaagagagcctgctgatggcgatgtgcatccgcgacatgatgcagggcaacccgaagctc
gcagaaaaagggctggtggaggagtcgctgggctacaacgccatcgccgccggtttccag
ggtcagcgccactggaccgatcaataccccaatggcgataccgccgaagcgctgctcaac
agctcttttgactggaacggggtgcgcgaaccgtttgtcgtcgctaccgaaaacgacagc
ctcaacggcgtggccatgctgatgggccatcagctcaccggcaccgcccaggtgtttgcc
gacgtacgcacctactggtcgccggatgccgttgaacgggtcaccgggcagccgctcacc
gggcgggcggagcacggcatcattcacctgattaactccggctctgcggcgctggacggc
tcctgccagcagcgcgacgcgcagggcaatccgacgatgaaaccccactgggagattgag
cagagcgaggcggatgcctgcctcgcggcgaccgaatggtgcccggcgatccacgaatac
ttccgcggcggcggcttctcttcccgcttcctgaccgaaggcggcgtgccgttcaccatg
acccgggtgaacatcatcaaaggtctggggccggtgctgcaaattgccgaaggctggagc
gtagcgctgcccaaagcgatgcacgaccagctcgacgcccgcaccaactccacctggccc
accacctggtttgccccacgcctgaccggcaagggcccgttcagcgatgtgtactcggtg
atggccaactggggcgccaaccacggcgtgctgaccatcggccacgttggcgcagatttc
attaccctcgccgccatgctgcgcattccggtctgcatgcacaacgtggaagaggcgaaa
atctatcgcccttccgcctgggccgcgcacggcatggatatcgagggccaggactaccgc
gcctgccagaactacgggccgctgtataagcgttaa

DBGET integrated database retrieval system