KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_43110Help
Entry
KPHS_43110        CDS       T01733                                 

Definition
DNA-binding transcriptional regulator GalR
Orthology
K02529  
LacI family transcriptional regulator
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4346945..4347961
Genome map
AA seq 338 aa AA seqDB search
MATIKDVARLAGVSVATVSRVINNSPKASEASRQSVGAAMETLNYHPNANARALAQQSTE
TVGLVVGDVSDPFFGAMVKAVEQVAYRTGNFLLIGNGYHNVQKERQAIEQLIRHRCAALV
VHAKMIPDEELAGLMKQIPGMVLINRILPGYETRCVALDDRYGAWLATRHLIQQGHTRIG
YLCSNHDISDAEDRLQGYYAALEESGLPCNDRLVTFAEPDESGGEQAMTELLGRGRHFSA
VACYNDSMAAGAMGVLNDNGIDVPREISLIGFDDVLISRYVRPRLTTVRYPIVTMATQAA
ELALALAEQRPAPEITHLFSPTLVRRHSVVAPQEGDKS
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggcgactattaaggatgtagcccgactcgcaggagtctccgtcgctaccgtctcccgc
gtcatcaacaactctcccaaagccagcgaagcttcgcgtcagtccgtgggcgcggcgatg
gaaaccctgaactatcaccccaacgcgaacgcccgggcgctggcccagcagtcaacggaa
accgtcggcctggtggtgggcgatgtctccgaccccttcttcggcgcgatggtcaaagcc
gtcgaacaggtggcctaccgcaccggcaattttttgctgattggcaatggctaccacaac
gtgcagaaggagcgccaggcgatagagcagctgatccgccatcgctgcgcggcgctggtg
gtgcacgccaaaatgatcccagatgaggaattggcggggttaatgaaacagatccccggc
atggtgctgatcaaccgcatcctgcccggatatgaaacccgctgcgtcgcgctggacgac
cgctacggcgcctggctggcgacccgccatttgatccagcaggggcacacgcgtatcggc
tatctgtgctcaaaccatgatatctccgatgcggaagatcggctgcaggggtactacgcg
gcgctggaggagagcggcctgccgtgcaacgaccggctggtcacgtttgccgagccggat
gaaagcggcggcgaacaggcgatgaccgaactgcttggccgcggccgccactttagcgcc
gtcgcctgctataacgactcgatggccgccggcgcgatgggggtgctgaatgacaatggc
atcgacgttccgcgggagatttcgctgattggcttcgacgatgtcctgatttcgcgctat
gtccgcccgcggttgactaccgtccgctatccgatcgtcacgatggcgacccaggcggcc
gagctggctttagccctggcggagcagcggccggcgccggagatcacccatctgttcagc
ccgacgctggtccgtcgtcactcggtggtcgccccgcaggaaggcgataagtcatag

DBGET integrated database retrieval system