KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_47260Help
Entry
KPHS_47260        CDS       T01733                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:kpm00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4743173..4744021)
Genome map
AA seq 282 aa AA seqDB search
MKLVAQGSTLDLSHPHVMGILNVTPDSFSDGGAHNSLIEAVKHANLMINAGATIIDIGGE
STRPGAAEVSVEEELARVIPVVEAIAQRFEVWISVDTSKAEVIRQSARAGAHIINDIRSL
TEPGALQAAAETGLPVCLMHMQGQPKTMQEAPKYEDVFADVERFFNEHIVRCEQAGIAKE
KLLLDPGFGFGKNLSHNYQLLARLGEFHHFGLPLLVGMSRKSMVGQLLNVGPSERLNGSL
ACAVIAAMQGAQIIRVHDVKETVEALRVVEATLAAKGKKRYE
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttgtagcccagggctcaaccctcgatctctctcaccctcacgtgatgggtatt
ctaaatgtgacgcctgactccttctccgatggcggcgcccataattcgctgattgaggcg
gtgaagcatgccaatctgatgatcaacgccggcgcgaccatcattgatatcggcggtgaa
tcgacgcggccaggggcggctgaggttagtgtggaagaggagcttgcgcgggtgataccg
gtggttgaagccattgcccagcgctttgaggtatggatctcagtggatacctccaaggcg
gaggttattcgccaatcggccagggccggggcgcatatcatcaacgatattcgttcgctg
accgagcccggcgcgctgcaggccgccgcggaaaccggactgccggtgtgtctgatgcat
atgcagggacaaccaaaaaccatgcaggaggcgccgaagtatgaggacgtcttcgccgat
gttgagcgtttttttaatgagcacattgtgcgctgcgaacaggcagggatcgcaaaagaa
aaattgctgctcgacccgggattcggtttcggtaaaaatctctcccacaattaccaactg
ttggccaggcttggggagtttcatcactttggtctgccgctgctggtcggtatgtcacgt
aagtcgatggtaggtcagttgctgaacgtcgggccgtcggagcggctgaacggcagcctg
gcgtgtgccgtcattgcagcaatgcagggcgcgcagattatccgcgtccatgatgtcaaa
gaaacggtagaagcgctgcgcgtggtggaagccaccctcgccgctaagggaaaaaaacgt
tatgagtaa

DBGET integrated database retrieval system