KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_49380Help
Entry
KPHS_49380        CDS       T01733                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KPHS_49380
Enzymes [BR:kpm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     KPHS_49380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4935075..4937168)
Genome map
AA seq 697 aa AA seqDB search
MESKRLDNAALAAGISPSYINAHGKPQSIAAVTKQRLLDAMHRSTAATKVAVNPLPNVKI
FTHGKKMSLPVAGRGEYQWILTTEDGKQYQGKTRGGETLPLPAKLPEGYHSLTLTQEGER
WHCRTIVAPARCYEPQPLKEGKKLWGTCVQLYTLRSEKNWGIGDFGDLRAMLPEIARRGG
SFIGLNPIHALYPANPESASPYSPSSRRWLNVIYIDVNAVEDFQRSEEAQAWWQSPATQQ
ALQAARETDDVDYTAVTTLKMTALRMAWKQFSRREDEQMTAFREFVLREGESLYWQAAFD
ALHAWQVQQDPLRWGWPAWPKAFQDIDSPEVKAFCVEHEDDVSFYLWLQWLAWSQFAACW
ETSQRDGMPIGLYRDLAVGVAEGGSETWCDRELYCLKASVGAPPDILGPLGQNWGLPPMD
PHIIAARAYEPFIDLLRANMQNCGALRIDHVMSVLRLWWIPYGETADHGAYVQYPVDDLL
SLLALESQRHRCMVIGEDLGTVPVEIVSKLRNSGVYSYKVLYFESDAEKTFRAPALYPEQ
SMAVATTHDLPTLRGYWESGDLTLGKALGLYPDEVVLRGLYQDRELAKQGLLDALHKYGC
LPKRAGHKASLMSMTGILNRGMQRYIADSNSALLGLQPEDWLEMATPVNIPGTSTEYPNW
RRKLSVTLEQMFADERVNKLIKDLDKRRKAASKKAAS
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atggagagtaaacgcctcgataatgccgcgctggcggcgggcatcagccccagctatatc
aacgcgcacggcaagccgcagtctatcgcggctgtcaccaaacagcgcctgctggatgcg
atgcatcgctctaccgccgccacgaaagtggcggttaacccgctgccgaacgtgaaaatt
ttcactcacggcaaaaaaatgtcgctgccggtggcaggacgcggtgagtatcagtggatc
ctgactactgaggacggtaagcagtatcaagggaaaacccgcggcggcgagacgctgccg
ctgccggccaaactgccggaggggtaccactccctgaccctcacccaggagggggagcgc
tggcactgccgaactatcgtcgcgccagcgcgctgctatgagccgcagccgctgaaagag
gggaaaaagctgtggggcacctgcgtgcagctgtataccctgcgctcagagaaaaactgg
gggatcggcgattttggcgatctgcgggccatgctgccggaaatcgcccgccgcggcggg
tcgtttattggccttaacccgattcatgccctctatccggcgaacccggagagcgccagc
ccctatagcccgtcttcacgtcgctggctgaacgttatttatatcgacgtcaacgcggtt
gaagatttccagcgtagcgaagaggcgcaggcgtggtggcagtctccggcaacgcagcag
gcactgcaggcggcgcgggaaacggacgatgtggattataccgccgtcactacgctgaaa
atgaccgcgctgcgtatggcgtggaaacaattctctcgtcgtgaagatgagcagatgaca
gcgttccgcgagtttgttctgcgcgaaggggaaagcctctactggcaggcggctttcgat
gcgctgcacgcctggcaggtacaacaggacccgctgcgctggggctggccggcctggccg
aaggcctttcaggatatcgacagcccggaagtgaaagccttctgcgttgagcatgaggat
gacgtcagtttctatctttggctgcagtggctggcctggagtcagtttgccgcctgctgg
gaaaccagccagcgtgacggcatgccgatcggcctctaccgcgacctggcggtgggcgtc
gccgagggcgggtcggaaacctggtgcgatcgtgaactgtactgcctgaaagcatccgta
ggcgcgccgccggatattctgggcccgctgggccagaactggggcctgccgccgatggat
ccgcatatcattgccgcccgcgcctatgagccgtttatcgacctgctgcgcgctaatatg
cagaactgcggcgcgttgcgcatcgatcacgtgatgtctgtgctgcgtctgtggtggatc
ccgtatggtgaaaccgccgaccatggcgcttacgttcagtatccggtcgacgatctgctg
tcgcttctggcgctggaaagccagcgtcatcgctgcatggtgatcggtgaagatctgggc
acggtaccggtggagatcgtcagcaagttacgcaacagcggcgtctattcttataaggtg
ctctattttgagagtgatgcagagaaaacgttccgcgcgccggcgctgtacccggagcaa
tcaatggctgtggcgacgacgcacgacctgcccactctccgcggctactgggaaagcggc
gatctgacgttaggtaaagcgctgggcctctatcctgatgaggtggtgctgcgcggactg
taccaggaccgcgagctggcgaaacaaggactgctggacgcgctgcataagtacggctgt
ctgcccaagcgcgccggccataaggcctcgctgatgagcatgacggggatcctcaaccgg
gggatgcagcgttatattgccgacagcaacagcgccctgctgggcctgcagccggaagac
tggctggagatggcgacgccggttaacattccgggcaccagcaccgagtacccgaactgg
cgccggaagctgtccgtcaccctggagcagatgtttgccgatgaacgggtcaataagctg
attaaggatctggataaacggcgcaaggccgcgagcaagaaagccgcctcctga

DBGET integrated database retrieval system