KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_50380Help
Entry
KPHS_50380        CDS       T01733                                 

Definition
(RefSeq) endo-1,4-D-glucanase
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(5048458..5049567)
Genome map
AA seq 369 aa AA seqDB search
MMKVLCGAVLSALLLAAGQVGAACQWPAWEQFKQAYVSPEGRVIDPSDARKISTSEGQSY
GLFFALAANDRAGFDKLLTWTQNNLAEGDLKQHLPGWLWGKKDDEQWTLLDSNSASDSDL
WIAWALLEAGRLWQQPQYTETGKALLARIVAEETVAVPGLGTMLLPGKVGFADDSGWRFN
PSYLPPQLATYFVRFGAPWPALRDSNLRLLLETAPKGFTPDWVRYEKGKGWQLKTEKPPI
GSYDAIRVYLWVGMLHDGDKQKARLLQRFAPMAAQTTEQGVPPEKVNIATGKTSGQGPVG
FSAAMLPFLQDDEARSVQRQRVADNYPGADAYYSAVLTLFGQGWDQHRFRFTASGELQPD
WNQECASSH
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaagttctttgtggcgcggtgctctcggcgctgctgctggcggcgggccaggtg
ggcgccgcctgccagtggcccgcctgggagcagtttaaacaagcgtacgtcagccccgag
ggacgggtgattgaccccagcgatgcgcgcaaaatctccacctcggaaggacagagctat
ggcctgtttttcgccctggcggccaacgatcgcgcagggttcgacaaactgctgacctgg
acgcagaacaacctggcggaaggcgatctgaaacaacatttgccgggctggctgtggggc
aaaaaggacgatgagcagtggaccctgctggacagcaactcggcgtccgactcggatctg
tggatagcctgggcgctgctggaggcgggccgcctgtggcaacagccgcagtacaccgag
accggaaaagccctgctggcgcggattgtcgctgaagagacggtggcggtgccgggcctc
ggcacgatgctgctgccgggaaaagtcggttttgccgatgacagcggctggcggtttaac
cccagctatcttccgccgcagctggccacctactttgtgcgttttggcgcgccgtggccc
gctctgcgcgacagtaacctgcgcctgctgctggagaccgcgccgaaaggctttaccccg
gactgggtgcgctatgagaaagggaaaggctggcagctgaaaaccgaaaagccgccgatc
ggcagctatgacgcgattcgcgtctacttgtgggtgggcatgctccatgatggcgataag
cagaaagcgcgtctgctgcaacgcttcgcgccgatggcggcgcagaccacggagcaggga
gtacccccggagaaagtgaatatcgccaccggcaaaaccagcggtcaggggccagtgggc
ttctccgcggcaatgctgccgtttttacaggacgacgaggcccggtcggtgcaacgccag
cgcgtcgccgataactatcccggcgcggatgcctactacagcgcagttctgacgctgttc
ggccagggttgggatcaacaccgttttcgtttcacggcgagtggtgaattacaacctgac
tggaaccaggaatgcgcaagctctcactaa

DBGET integrated database retrieval system