KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_50460Help
Entry
KPHS_50460        CDS       T01733                                 

Definition
endo-1,4-D-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KPHS_50460
Enzymes [BR:kpm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     KPHS_50460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5059176..5060177)
Genome map
AA seq 333 aa AA seqDB search
MPLRALVAVIVTTVVMLVPRAWADTAWERYKARFMMPDGRIIDTANGNVSHTEGQGFAML
LAVANNDRPAFDKLWQWTDNTLRNKSNGLFYWRYNPVAPDPIADKNNASDGDTLIAWALL
RAQKQWQDKRYAIASDAITAALLKSTVVTFAGRQVMLPGVKGFNLNDHLNLNPSYFIFPA
WRAFAERTHLTAWRTLQSDGQALLGQMGWGKSHLPSDWVALRADGKMLPAKEWPPRMSFD
AIRIPLYLSWADPHSALLAPWKAWMQSYPRLQTPAWINVSTNEVAPWYMAGGLLAVRDLT
LGEPQEAPQIDDKDDYYSASLKLLVWLAKQDQR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgcgtgctttagtggcggtgatagtgacaacggtagtgatgctggtgcccagg
gcgtgggcggatacggcctgggagcgctataaggcccgttttatgatgccggatggtcgt
atcattgataccgccaatggcaatgtgtcgcatacggaaggtcagggcttcgccatgctc
ctggcggtggcgaataacgatcgtccggcgttcgacaagctgtggcagtggacggacaac
accctgcgcaacaagtctaacgggttgttttactggcgctataacccggtggcgccggac
cctatcgccgataaaaacaacgcctccgatggcgataccctgatcgcctgggcgctgctg
cgcgcgcaaaagcagtggcaggataagcgctatgcgattgcctctgacgccatcaccgcc
gccctgctgaagtctacggtggtgactttcgccggtcgccaggtgatgctcccgggcgtg
aaagggttcaacctcaatgatcacctgaaccttaacccttcctatttcatcttcccggcc
tggcgcgccttcgcggagcggacgcatctcaccgcctggcggacattgcagagcgacgga
caggcgctgctggggcagatgggctgggggaaatcacatctacccagcgactgggtggcg
ctgcgggcggatggcaagatgctgccagccaaagagtggccgccgcggatgagtttcgat
gcgatccgtatcccgctgtatctctcgtgggccgatccgcacagcgccttgctcgcgccc
tggaaggcctggatgcagagttacccgcgcctgcaaaccccggcgtggatcaacgtcagc
accaacgaggtggccccctggtatatggccggcggcctgttggcggtgcgcgatctgacg
ctgggtgaaccgcaggaggcgccgcagattgacgacaaggatgattattactctgccagc
ctcaagctgttggtctggctggcgaaacaggatcagcgctaa

DBGET integrated database retrieval system