KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_51620Help
Entry
KPHS_51620        CDS       T01733                                 

Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
kpm00230  Purine metabolism
kpm01100  Metabolic pathways
Module
kpm_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    KPHS_51620
Enzymes [BR:kpm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     KPHS_51620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 RsgA_GTPase AAA_33 MMR_HSR1 AAA_22 ABC_tran AAA_18 AAA Viral_helicase1 CPT AAA_29
Motif
Other DBs
NCBI-GeneID: 11850233
NCBI-ProteinID: YP_005229462
UniProt: A0A0H3GUV0
Position
5180816..5181439
Genome map
AA seq 207 aa AA seqDB search
MAQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRAPRPGEVHGEHYFFVNHD
EFRSMIGENAFLEHAEVFGNYYGTSRKAIEQVLATGVDVFLDIDWQGAQQIRKSMPGARS
IFILPPSKDELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTALSDLK
NIIRAERLRMSRQKQRHGALITKLLAD
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaggcacgctttatattgtttccgcccctagcggcgcgggtaaatccagcctg
attcaggctttattaaaaacccaaccgttgtatgacacccaggtatcggtctcccatacc
acgcgggcgccgcgtccgggtgaagtgcacggcgaacactatttcttcgtgaatcacgac
gaattccgctcgatgattggcgaaaacgcgtttctggaacatgcagaggtctttggcaac
tattacggcacgtcgcgtaaagcgatcgagcaggtgctggcgaccggcgtcgatgtcttc
ctcgatatcgactggcaaggcgcgcagcagatccgtaaaagcatgcccggcgcgcgcagt
atttttattctgccgccgtcaaaagatgaactggaccgtcgcctgcgcggccgcggccag
gacagcgaagaggtgatcgcgaaacggatggcccaggccgttgcggaaatgagccattac
gcggaatatgattacctgattgtgaacgatgattttgacaccgccctgagcgacctgaaa
aatatcatccgcgctgaacgtctgcgcatgagccgccaaaagcagcgacatggcgcttta
atcaccaaactattggcagactga

DBGET integrated database retrieval system