KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_51710Help
Entry
KPHS_51710        CDS       T01733                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KPHS_51710
   01230 Biosynthesis of amino acids
    KPHS_51710
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPHS_51710
   00051 Fructose and mannose metabolism
    KPHS_51710
   00562 Inositol phosphate metabolism
    KPHS_51710
Enzymes [BR:kpm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     KPHS_51710
Exosome [BR:kpm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   KPHS_51710
  Exosomal proteins of bladder cancer cells
   KPHS_51710
  Exosomal proteins of melanoma cells
   KPHS_51710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5189899..5190666
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVNELVANLRTELAGVSGCAVAIAPPEMYLDLAKRAAEGSHIH
LGAQNVDVNLSGAFTGETSAEMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQG
LTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGVVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKADAKIAEQVIIQYGGSVNAGNAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAEAAKKA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccacatggtaaac
gaactggttgcgaacctgcgtaccgagctggctggcgtaagcggctgtgcagttgccatc
gccccgccggaaatgtatctggacctggctaagcgcgcggcagaaggcagccacattcac
ctgggcgcgcagaacgttgacgtgaacctgtccggcgcattcaccggtgaaacctccgcc
gaaatgctgaaagatatcggcgcgcagtacatcatcatcggccactccgagcgtcgtacc
taccacaaagaatccgacgagctgatcgcgaagaaattcgccgtgctgaaagagcagggt
ctgaccccggttctgtgcatcggtgaaaccgaagccgaaaacgaagcgggcaaaacggaa
gaagtttgcgcacgtcagatcgacgccgtgctgaaaacccagggcgctgccgctttcgaa
ggcgtggttatcgcttacgaaccagtatgggctatcggtaccggcaaatcagcgaccccg
gctcaggcgcaggcggtgcacaaattcatccgtgaccacattgctaaagctgacgccaaa
atcgctgagcaagtgatcatccagtacggcggttccgttaacgctggcaacgccgcagag
ctgttcacccagccggacatcgacggcgcgctggttggcggcgcctccctgaaagctgac
gctttcgcggtgatcgttaaagcagcagaagcagcgaaaaaagcgtaa

DBGET integrated database retrieval system